KEGG   Chlorobium phaeovibrioides: Cvib_1672Help
Entry
Cvib_1672         CDS       T00499                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00500  Starch and sucrose metabolism
pvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cvib_1672
Enzymes [BR:pvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Cvib_1672
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Cvib_1672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH Glyco_hydro_77 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ABP37682
UniProt: A4SGS3
LinkDB All DBs
Position
complement(1861150..1864452)
Genome map
AA seq 1100 aa AA seqDB search
MYQPEPLWYKDAIIYEAHVKTFFDSNNDGIGDFQGLRQKLAYLESLGVTAIWLLPFYPSP
LRDDGYDIADYMTVNPDYGTLEDFREFLEEAHNRGLKVITELVVNHTSDQHAWFQRARKA
PAGSPERDFYVWSDDPNKYSETRIIFQDFEASNWTWDPVAGQYYWHRFFHHQPDLNFENP
EVQQALFSVLDFWLGMGVDGLRLDAVPYLYEAEGTNCENLPQTFEFLRSMRKHVDEHYPN
RMLLAEANQWPEDSAAYLGDGDMCHMNFHFPLMPRMYMALATEDRFPILDILEQTPEIPE
ECQWASFLRNHDELTLEMVTDEERDYMRRVYANDPKARINLGIRRRLAPLMNNDRRRIEL
MNIMLLSLPGTPVLYYGDEIGMGDNYYLGDRDGVRTPMQWNGDRNAGFSRSNPQQLLLPV
IIDPEYHYEAVNVEVQESNVNSLLWWTRHAISTARRYKSLSRGTIEFLQVSNPKVLIFIR
RFEDETVLSVINLSRNAQAVAIDLADFEGYTPEEVFSMNRFPKIRKAPYMVALGSYGYFW
LNLVPEVDGALARPCMDTPFAEVAKWPSLFAGRSRERLETSILPGYFRASRWFGGKARNV
MRITIIDTMPVAGMDMSKLLVTEVRYSSGENDLYQLPVCFTPLAVVSPSDDNFAKRVIAR
VVVGGEEGYLCDATFENEFLSRLFSLMVGSGKWQGTAGVVSGLKGSAIEAFLDMTDDKEP
EPVLMGVEQTNTSVRFHDSLCLKLYRRIEVGVSPEIEMCGALTEKTSFESLPKYLGSLNY
DQGRSSRYSIGILQNFVQNEGDAWQLSLGQVQRYYADVLTRIAAGIELPEMARLSGTPVA
VPEIMYELIGDAYLGMIEKLAERTAEMHLSLASLTAEPAFAPEAFTTLYQRSIYQAMCEQ
VKRAMILIGQLMPSMEPEQRELCSLLVKNQKTILQQFEPIRKEKIDTLKIRIHGDYHLGQ
VLFTGKDFVIIDFEGEPARPISERKIKRSVFRDISGMLRSFDYAAFNVLHLNESVVRPEN
RHELEPWADRWSNAVGQHFLDTYFEKTAGSDIVPQNPRQREHLMNAYLMNKAVYELNYEL
NNRPQWVGIPIRGILKMLDI
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaacctgaaccgctctggtacaaagacgccattatctacgaggctcatgtcaag
acgttcttcgacagcaacaatgacggaatcggcgacttccaggggcttcgccagaagctc
gcctatctggaaagtctcggcgtgaccgccatctggctactccctttctacccctcgccc
ctgcgcgacgacggatacgacattgccgactatatgacggtcaaccctgattacgggacg
ctggaggatttcagggagtttcttgaggaggcccataaccgcgggttgaaggtgatcacc
gagcttgtggtcaaccacacctccgaccagcacgcatggttccagcgggcccgcaaagcg
ccggccggctcacccgagcgggatttctatgtctggagcgacgatccgaataaatattcc
gagacccgtatcatcttccaggacttcgaggcttcgaactggacctgggatccggttgca
ggccagtattactggcaccgtttcttccatcaccagcccgacctgaactttgaaaacccc
gaggttcagcaggcgctcttcagcgtgcttgacttctggctcggcatgggcgttgacggc
ctgcggcttgacgcagttccctacctctacgaagcggaggggaccaactgcgagaacctg
ccccagaccttcgagttcctccggagtatgcgaaagcatgttgatgagcactatcccaac
aggatgctgcttgccgaggccaaccagtggccggaagactccgcagcctaccttggcgat
ggtgacatgtgccacatgaacttccacttccccctcatgccgaggatgtacatggccctt
gccaccgaggaccgtttccccattctcgacattcttgaacagaccccggagatccccgag
gagtgccagtgggcatcgttccttcgcaaccatgatgaactgacgcttgagatggtgacc
gatgaggagcgcgactacatgcgccgcgtctacgccaatgaccccaaggcccgcatcaac
cttggtatccgccgccgcctcgcccctttgatgaacaacgaccggcgccgcatagagctg
atgaacatcatgctcctttcgctgcccggcaccccggtgctctactatggcgacgaaatc
ggcatgggtgacaactactacctcggcgatagggacggtgtccgtaccccgatgcagtgg
aatggcgaccgtaatgcgggcttctcgcgctcgaacccccagcagctgcttcttccggtc
atcattgatccggaataccactacgaggcggtcaatgtggaggtgcaggagagcaatgtg
aactcgctgctctggtggacgcgccacgccatctccaccgctcgccgttacaagtcgctc
agccgcggaacaatagagttcctgcaggtaagcaacccgaaagtgctgattttcatccgc
cgctttgaggatgaaaccgtgttgtcggtcatcaacctttcccgcaatgcccaggccgtt
gccatagaccttgctgactttgagggatacactcccgaagaggtgttcagcatgaaccgg
ttccctaaaatccggaaagccccttatatggtggctctgggttcttacggatatttctgg
ttgaaccttgttcccgaagtggacggagccctcgcacggccctgcatggacacccctttc
gcagaagtcgcaaaatggccctccctgtttgccggcaggagccgcgagcgacttgaaacc
tccattcttcccggttacttccgtgcaagccgctggtttggcggcaaggcccgtaatgtc
atgcgaatcaccatcatcgacaccatgccggttgcggggatggatatgtccaagctgctt
gtgaccgaagtccgttactcaagcggtgagaacgatctctatcagcttcccgtctgtttc
actcctctcgcagtggtttctccttccgatgacaacttcgccaaacgggtcattgcccgt
gtggttgtgggcggtgaagagggttacctgtgcgatgcaacctttgagaacgagttcctc
agccgcctcttcagcctcatggttggctctggcaaatggcagggcacggccggtgttgtt
tcaggcctgaaaggttccgcaattgaggccttccttgacatgacagatgataaagagccg
gagccggttctgatgggtgtggagcagaccaacacttcagtccgttttcacgattccctc
tgcctcaagctctatcgccgcattgaggttggtgtttcgcccgaaatcgagatgtgcggt
gctctgactgaaaaaacttcatttgaaagtctccccaaatacctcggttcgctgaactac
gatcagggccgttcctcccgctactccataggcattctccagaacttcgtgcagaacgaa
ggggacgcctggcaactgtcgcttggtcaggtacagcggtactatgccgatgtgctcacc
aggatagctgcgggtattgaactgcccgaaatggcgcgcctcagcggcacacccgtcgct
gttcccgaaatcatgtatgaactgatcggtgacgcctatctcggtatgattgaaaaactt
gcagagcggacggccgagatgcacctctctcttgcttcactgactgccgaacctgccttt
gctcctgaagcgttcaccacgctctaccagcgttccatctatcaggcgatgtgcgagcag
gtcaagcgggcaatgattctcattggtcagcttatgccttccatggagccggaacaacgg
gaactctgctctcttctggtcaaaaaccagaaaacgatactccagcagttcgagccgatc
cgcaaggagaagatcgatacgctgaagattcgtatccatggcgactaccatctcggtcag
gtgctctttaccggtaaggattttgtgatcattgattttgaaggcgagccggccaggccg
atttccgaacgcaaaatcaagcgctctgtcttccgcgacatttcaggaatgcttcgttcg
ttcgactatgcggccttcaatgtgcttcatttgaatgaatcagtggtgcgacccgaaaac
cgccacgagcttgagccatgggcagaccgctggagcaacgccgttgggcagcatttcctc
gacacctacttcgagaaaactgccggcagcgacattgtgccgcagaacccccggcaacgg
gaacatctgatgaacgcctacctgatgaacaaggcggtttacgaactcaattacgagctc
aacaaccggccgcagtgggtgggtattcccatacggggcatcctgaagatgctcgacata
taa

DBGET integrated database retrieval system