KEGG   Proteus mirabilis CYPV1: AOB99_01995Help
Entry
AOB99_01995       CDS       T04093                                 

Gene name
fadA
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
pvl  Proteus mirabilis CYPV1
Pathway
pvl00071  Fatty acid degradation
pvl00280  Valine, leucine and isoleucine degradation
pvl00281  Geraniol degradation
pvl00362  Benzoate degradation
pvl00592  alpha-Linolenic acid metabolism
pvl01100  Metabolic pathways
pvl01110  Biosynthesis of secondary metabolites
pvl01120  Microbial metabolism in diverse environments
pvl01130  Biosynthesis of antibiotics
pvl01212  Fatty acid metabolism
Module
pvl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pvl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOB99_01995 (fadA)
   00592 alpha-Linolenic acid metabolism
    AOB99_01995 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOB99_01995 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    AOB99_01995 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOB99_01995 (fadA)
   00642 Ethylbenzene degradation
    AOB99_01995 (fadA)
Enzymes [BR:pvl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     AOB99_01995 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALE24243
UniProt: A0A506ZXR5
LinkDB All DBs
Position
complement(395237..396400)
Genome map
AA seq 387 aa AA seqDB search
MEKVVIIDGVRTPMGRSKGGAFRHVRAENLSAQLMQALLKRNPDIDPNDIGDVIWGCVQQ
TLEQGFNIARNAALLAELPHKVPAVTVNRLCGSSMQALHDGARQIMLGESQVALIGGVEH
MGHVPMTYNADFNPALNLSVAKASFSMGLTAEMLAKSFQISREEQDKFAYRSHHLAALAT
QKGYFDNELVAINGHDAAGDFIRVSTDEVIRYNPSLDELAQLRPVFDPATGSVTAGNSSA
VSDGASAMFITSESYAKQHHLKPRAIIRSMAVTGCDPAIMGYGPVPATEIALKKAGLTLS
DIDIFELNEAFAAQSLACMKKMNLLDSIDDKINLNGGAIALGHPLGCSGARITTTLLNIM
ERKDAQLGLATMCIGLGQGIATIIERV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggttgtcataattgatggtgttcgcaccccaatgggacgttcaaaaggtgga
gcatttcgccatgtaagagctgaaaatctctctgcgcaattaatgcaagctttgcttaag
cgtaaccctgatattgatcccaatgatattggcgatgtgatttggggctgtgtgcaacaa
actttagagcaaggctttaatattgcacgtaatgccgcactattagcagaattaccacat
aaagttccggcagtaaccgtcaatcgtttatgtggctcttcgatgcaagccttgcatgac
ggtgctcgccaaattatgttaggagagagccaagttgctttaattggtggcgttgaacat
atgggtcatgtaccgatgacctataatgctgactttaacccagcattaaatctttctgtg
gcaaaggcttcattctcaatggggttaactgcagaaatgttagcaaaatcatttcaaata
tctcgcgaagaacaagacaaattcgcctatcgctcacaccatttagccgccctcgcgacc
caaaaaggctattttgacaacgaacttgttgccattaatggtcatgatgcagcaggagat
tttatacgcgtcagcacggatgaggttatccgttataacccaagtcttgatgaattagca
caacttagacccgtgtttgatcccgccacgggctccgtcactgcggggaattcatcggcc
gtctctgatggggcatccgcgatgtttatcacgagcgaaagttatgctaagcaacatcat
ttaaaaccccgtgcaattattcgttcgatggcggtaacaggttgtgatccggcaatcatg
ggatatggtcccgttcctgccactgaaatagcgctaaagaaagcagggttaaccctcagt
gatattgatatctttgaacttaacgaagcctttgcagcgcaatccttagcttgcatgaaa
aaaatgaatttactcgatagcattgatgacaaaatcaatcttaatggtggtgctattgca
cttgggcatccattaggttgttctggtgccagaataaccaccacgctattaaatattatg
gagcgtaaagatgcacaattaggattagcgacaatgtgtattggattaggccaagggata
gcaaccattattgagcgagtttaa

DBGET integrated database retrieval system