KEGG   Proteus mirabilis CYPV1: AOB99_03740Help
Entry
AOB99_03740       CDS       T04093                                 

Definition
(GenBank) iron ABC transporter permease
  KO
K02011  iron(III) transport system permease protein
Organism
pvl  Proteus mirabilis CYPV1
Pathway
pvl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pvl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AOB99_03740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pvl02000]
    AOB99_03740
Transporters [BR:pvl02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    AOB99_03740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ALE24565
LinkDB All DBs
Position
complement(803704..805782)
Genome map
AA seq 692 aa AA seqDB search
MSHTLALSEKKRWDPIFLWILIAWMAFILMPSWSLDYGLFDSTADELLTSYGWSNLNISL
LWFLLPSILLIRPLHPVGRENRIRHYFDASFAFFCAFITIVTATMEGRGLGYSVIVLFIS
LGMIAKHALTRLEWLGGDSFVIGSLITVVALIGVFIIFPSVAIFIPMFQDSAGNFAPFEF
IAILSQAHIVQVMINSILLSIAVGIGCTFFGLILAIYTSRIAVRSAIIGRVFSILPIVTP
PFVVGLGVTLMMGRSGYITEFLATYAGLENTNWLYGFTGIWLAQVLAFTPMSFMILDGAI
KTIHPSLEEASYTLRANRYQTFFHVFMPLLKPALANAFLIVIVQSLADFSNPLVLGGNFD
VIATQIYFYITGSQLDYQAASTLGASLLVFSLLVFCIQYMWIGKRSYVTVSGKSYRGDVQ
PLPTSLVTFVTSVLGIWVIFNILLYGSIFYGSFTVNWGVDYTLTFDNFIKLFGQGMSDGA
WPSLLDTLLYAGIAAPITAILGLLIAYIVVRQDFKGKKSIEFTTMLCFAVPGTVAGVSYI
LAFNDSPFYLTGTAAIVIISMTMRNVPVGIRAGIAGLGQIDKSLDEASLSLRANSMRTIL
YVLLPLLRPAILSALIYSFVRAITTVSAIVFLVTPETRVATAYILNRVEDGEYGVAIAYG
SILIIVMLAIIFLFDYLIGEARVSRSKAKNAQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacacactcgctttgtctgaaaaaaagaggtgggatcccatatttttatggatc
ctgattgcatggatggcatttatattaatgccttcatggagccttgattatggtctattt
gattctaccgcagatgaattacttacctcttatggctggagtaacttaaatatcagtctg
ctctggtttttacttcccagcatactattaattcgtcctttacatcctgtagggcgagaa
aatcgtattcgccactattttgatgcaagttttgcctttttctgcgcctttatcactatt
gttaccgcaacgatggaaggtcgtggtctgggttattcggttatcgtgctatttatttca
ttaggaatgatagccaagcatgctttaacacgcttagagtggttagggggtgatagcttt
gtgattggctcattaatcacagttgtcgccttaatcggtgtttttattatctttccaagt
gtcgctatctttattccgatgtttcaagatagtgctggcaattttgccccctttgaattt
attgccattctcagccaagcccatattgttcaggtgatgatcaattcaatcttactgtct
atcgcagttggtattggctgtactttttttggtttgatcctcgccatttatacatcacgt
attgcagtaagatcagcgattattggtcgagtattttctattttacctattgtcactccc
ccttttgttgtgggtttaggtgtgaccttgatgatgggacgttcaggttatatcactgaa
tttttggcaacttatgcaggtttagaaaataccaactggttatatggctttacgggaatt
tggcttgcacaagtacttgcctttacccctatgtcttttatgatcttagatggtgcaatt
aaaactatccatccgtcattagaagaggcttcttatacccttagagctaatcgctaccaa
acattctttcatgtttttatgccgttactaaaaccagcattagccaatgcctttttgatc
gttatagtgcaatcattggctgattttagtaacccattggtgctaggtggcaactttgac
gtgattgccactcaaatttatttctatatcaccggctctcaacttgattaccaagcagca
agtacgttaggtgcttcactgttggtattctcattattagtgttctgcattcaatatatg
tggattggcaaacgctcatatgtcacggtgtcaggtaaatcctatcgtggtgatgttcaa
ccattacccacctccttagtaacctttgtcactagcgtgttgggtatttgggttatcttt
aatatcttactctatggcagcattttctacggcagttttacggttaactggggtgtggat
tacaccttaacctttgataactttattaaattatttggtcaagggatgagcgatggcgca
tggccatcattacttgataccttactttatgcgggtatcgcagcacctattaccgctatt
ttagggcttttgatcgcctatattgtcgtgcgccaagattttaaaggtaaaaagagtatc
gaatttacgactatgctctgttttgccgttcccggtactgttgcgggggtctcttatatc
ttggcatttaatgattcaccgttttatttaacaggaacggcagccattgtgattatctca
atgaccatgcgtaacgtgcccgtgggaatacgagcgggtattgcaggattagggcaaatc
gataaatcgttggatgaggcgtcattaagtttaagagcaaattcaatgcgaactattttg
tatgtgctattgcctttattacgccccgcgattttatccgctttaatttatagttttgtc
cgcgcgataaccaccgtcagtgcgattgtattcttagtcacccctgaaactcgcgttgct
accgcttatattttaaatcgtgttgaggatggtgaatacggcgtcgcaattgcctatggc
tcgattttaatcatcgtgatgttggctattattttcttatttgactatttgattggcgaa
gcccgtgtttcacgctctaaagccaaaaatgcacagtaa

DBGET integrated database retrieval system