KEGG   Proteus mirabilis CYPV1: AOB99_06745Help
Entry
AOB99_06745       CDS       T04093                                 

Definition
(GenBank) 3-oxoacyl-ACP synthase
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
pvl  Proteus mirabilis CYPV1
Pathway
pvl00061  Fatty acid biosynthesis
pvl00780  Biotin metabolism
pvl01100  Metabolic pathways
pvl01212  Fatty acid metabolism
Module
pvl_M00083  Fatty acid biosynthesis, elongation
pvl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pvl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AOB99_06745
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AOB99_06745
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pvl01004]
    AOB99_06745
Enzymes [BR:pvl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     AOB99_06745
Lipid biosynthesis proteins [BR:pvl01004]
 Fatty acid synthase
  Component type
   AOB99_06745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: ALE25095
UniProt: A0A1Z1SXU0
LinkDB All DBs
Position
1484535..1485776
Genome map
AA seq 413 aa AA seqDB search
MSKRRVVVTGLGMLSPVGNNAEASWKAVCAGQSGIGLIEEFDTSHHATKFAGLVKDFNHE
DYNLSRKDARKMDLFIQYGIAAGVQAIADSGLEVTEANASRIGAAIGSGIGGLGLIEENH
SSLINGGPRKISPFFVPSTIINMVAGHLSIIYGLRGPTISIATACTSGVHNIGHAARIIA
YGDADVMLAGGAEKATTPLGVGGFGAVRALSTRNDDPQAASRPWDKDRDGFVLGDGAGVL
VLEEYEHAKARGAKIYAEVVGFGMSSDAYHMTSPAENGAGGALAMENALKDAGITAADVG
YINAHGTSTNAGDIAEAQAVETVFGKGTDVLVSSTKSMTGHLLGAAGAIESIFTILSLRD
QIVPPTINLDNQDEHCHLDFVPHKARKVENMDYALCNSFGFGGTNGSILFKRV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaagcgtcgtgtagttgtgaccggactaggcatgttatctcctgtcggtaataac
gcagaagcttcttggaaagctgtgtgtgccggacagagtggtatcggccttatcgaagaa
tttgacaccagtcatcatgcgactaaattcgcaggattggtaaaagatttcaatcatgaa
gattacaatctttcgcgtaaagatgcgcgcaagatggatctctttattcaatatggtatt
gcagcaggtgttcaagccattgcggattcaggtcttgaagtaacagaagccaatgcaagt
cgtatcggagctgctattggttctggtattggtggcttaggccttatcgaggaaaatcat
tcatcattaatcaatggtggccctcgtaaaattagcccattctttgttccttcaaccatc
attaatatggttgctggccatttaagcattatttatggcttacgtggaccgaccatttct
atcgcaactgcatgtacatcaggtgtgcataatatcgggcatgccgctcgtattatcgct
tatggtgatgctgatgtgatgttagcgggcggtgctgaaaaagcaacaacaccattaggt
gttggtggttttggtgcagtacgtgcattatcaacacgtaatgatgatcctcaagcggca
agtcgcccatgggataaagatcgtgatggtttcgtgttaggtgatggtgcaggtgtgtta
gtcctcgaagagtatgaacacgctaaagcacgtggcgctaaaatttatgcagaagttgtt
ggctttggtatgagtagtgatgcttaccatatgacctctcctgcagaaaatggtgcgggt
ggtgcacttgcaatggaaaacgcattgaaagatgcgggtattactgctgctgatgtcggt
tatatcaacgcgcatggtacttctactaatgcgggtgatattgcagaagcgcaagctgtt
gaaacggtatttggcaaagggactgatgtattagttagctcaacaaaatcgatgacgggt
cacttattaggtgctgccggggcgattgagtctatctttactattttgtctctacgtgac
caaattgtaccgccaacaatcaatcttgataatcaagatgaacattgtcaccttgatttc
gtaccacataaagcgcgtaaagttgagaacatggattatgcactatgtaactcatttggc
tttggcggtaccaacggttcgattctctttaagcgtgtgtaa

DBGET integrated database retrieval system