KEGG   Proteus mirabilis CYPV1: AOB99_08595Help
Entry
AOB99_08595       CDS       T04093                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pvl  Proteus mirabilis CYPV1
Brite
Enzymes [BR:pvl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AOB99_08595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ALE25429
UniProt: A0A1Z1SVT6
LinkDB All DBs
Position
complement(1886590..1887114)
Genome map
AA seq 174 aa AA seqDB search
MKLIPLLLSGLLFTSVASAASLDVTLKEALPTGAGDDIGVVTITETDYGLLFTPKLTGLT
PGVHGFHIHANGSCEPDMKDGKPVPALKAGGHLDPENKGVHLGPYNKEGHLGDLPGLVAN
SQGDADYAVLAPRLTKLDQIKDKALMVHVGGDNYSDNPEALGGGGARMACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatacctttgttactctctggattactctttacatcggttgccagtgcggcg
agcttagatgttacgttaaaagaagccttacctacaggggcgggtgatgatattggtgtt
gtcactattaccgaaaccgattatgggctgttatttacgccaaaacttactgggttaaca
ccgggtgttcatggttttcatatccatgctaatggctcttgtgagccagatatgaaagat
ggaaaacctgttccagcattaaaagcgggtggtcatcttgatcctgaaaataaaggtgtt
cacttagggccttataacaaagaagggcatttaggtgatctacctggtttggttgccaat
agtcaaggtgacgctgattatgccgttcttgctcctagactgactaagcttgatcaaatt
aaagataaagccttaatggttcacgttgggggagataactactcagataacccagaagcg
cttggcggtggtggtgctagaatggcatgtggtgtgattaaataa

DBGET integrated database retrieval system