KEGG   Proteus mirabilis CYPV1: AOB99_10850Help
Entry
AOB99_10850       CDS       T04093                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pvl  Proteus mirabilis CYPV1
Pathway
pvl00473  D-Alanine metabolism
pvl01100  Metabolic pathways
pvl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pvl00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AOB99_10850
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AOB99_10850
Enzymes [BR:pvl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AOB99_10850
Peptidoglycan biosynthesis and degradation proteins [BR:pvl01011]
 Precursor biosynthesis
  Racemase
   AOB99_10850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Peptidase_U32_C Spherulin4
Motif
Other DBs
NCBI-ProteinID: ALE25844
UniProt: A0A1Z1STG0
LinkDB All DBs
Structure
PDB: 

Position
complement(2378356..2379579)
Genome map
AA seq 407 aa AA seqDB search
MSLAIRYLALLPLFVITACQQPVNYNPPATQVAQAQPAIVNNSWIEISRSALDFNVKKVQ
SLLGKQSSLCAVLKGDAYGHDLSLVAPIMIENNVQCIGVTNNQELKEVRDLGFKGRLMRV
RNATEQEMAQATNYNVEELIGDLDMAKRLDAIAKQQNKVIPIHLALNSGGMSRNGLEVDN
KSGLEKAKQISQLANLKVVGIMSHYPEEDANKVREDLARFKQQSQQVLEVMGLERNNVTL
HMANTFATITVPESWLDMVRVGGIFYGDTIASTDYKRVMTFKSNIASINYYPKGNTVGYD
RTYTLKRDSVLANIPVGYADGYRRVFSNAGHALIAGQRVPVLGKTSMNTVMVDITSLNNI
KPGDEVVFFGKQGNSEITAEEIEDISGALFTEMSILWGATNQRVLVD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtctttagctattcgatatcttgcgttattaccacttttcgttattactgcttgccaa
cagcctgtaaattataatccaccagcaactcaagtggctcaagctcagcctgctattgtc
aataattcatggattgaaatttcacgaagcgcactcgactttaatgtaaaaaaagtccaa
tcattattaggtaagcaatcctctctttgtgcagtgttaaaaggagatgcttatgggcat
gatttatcgttagttgccccaattatgatagaaaataatgtgcaatgtattggtgtaaca
aataaccaagaattaaaagaagtacgtgatttaggatttaaaggccgtttaatgcgagtg
cgtaatgcgacagaacaagaaatggcacaggcaaccaactataacgtagaagagttaatt
ggtgatcttgatatggcaaaaagattagatgctattgccaagcaacaaaataaagtcatt
cctattcatttagcattaaattcaggtggcatgtctcgtaatggtttagaggtcgataat
aaatctgggcttgaaaaagcaaaacaaatttctcaattagctaacctaaaagtggttggt
attatgtctcattatcccgaagaagatgctaataaagtaagggaagatctggctcgtttt
aagcaacaatctcagcaagtgttagaggtgatgggattagagcgtaacaatgtcacatta
catatggcaaatacctttgcgacaattaccgtgcctgagtcatggctggatatggtacgt
gtgggaggtattttttatggtgataccattgcgagtacagactataaacgtgtgatgacc
tttaaatctaacattgcttcaattaattattatcctaaaggtaatacggttggttatgat
cgtacttacacattaaaacgtgactcagtactagccaatattcctgtaggttatgcagat
ggttatcgtcgcgtttttagtaatgcggggcatgcattaattgctgggcaacgcgtacct
gttttaggaaaaacatcaatgaataccgttatggttgatattaccagtcttaacaatatc
aaaccaggtgatgaagttgtattttttggcaaacaaggtaatagcgaaattaccgcagaa
gaaattgaagatatcagtggtgcattgtttaccgaaatgtcaattttatggggagcaacc
aatcaacgggtattagttgattaa

DBGET integrated database retrieval system