KEGG   Proteus mirabilis CYPV1: AOB99_14480Help
Entry
AOB99_14480       CDS       T04093                                 

Definition
(GenBank) metabolite transporter
  KO
K08368  MFS transporter, putative metabolite transport protein
Organism
pvl  Proteus mirabilis CYPV1
Brite
KEGG Orthology (KO) [BR:pvl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pvl02000]
    AOB99_14480
Transporters [BR:pvl02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Others
    AOB99_14480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 MFS_4 PAS_8
Motif
Other DBs
NCBI-ProteinID: ALE26489
LinkDB All DBs
Position
complement(3210567..3211889)
Genome map
AA seq 440 aa AA seqDB search
MQPRNFDDIRFTSVHRRVMLWGSGGPFLDGYVLVIIGVALEQLTPILQLDTRWIGLLGAA
TLAGLFIGTSLFGYICDKVGRRKMFLVDIVAIAVISIATMFVSTPIGLLVMRFLIGIVIG
ADYPIATSMITEFSNKKQRAFAVGFIAAMWYIGATCANLVGYLLYDVQDGWRWMLGSAFI
PCVIILIGRFDLPESPLWLIRQGRIKECNEMMIKLFGEPVVFEAEDAKTTRFIELFNKRH
FSFVLFVAVIWTCQVIPMFAIYTFGPQIVGLLGWDTGRSAALGNVVISLFFMLGCIPAMF
WLNQTGRRPLLIGSFAMMTLALFTLGIFPNLPILFVILAFATYAFFSGGPGILQWLYPNE
LFPTDIRASAVGVIMSISRIGTVISTCALPAFIATYGINTTMLVGAAISLFGMMVSVLFA
PETKGLTLKQTSTMPMRRGK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccagaaactttgatgatattcgttttacctcagtacatcgtcgagtgatgtta
tggggaagtggcggcccttttcttgatggttatgtattagtcattattggtgtggcgctc
gaacaattaacacctatattacagcttgatacgcgatggattggtttgcttggtgcggca
acattagcagggctttttattggtacctcactttttggctatatttgtgacaaagtaggg
cgccgtaaaatgttcctcgttgatattgtggctattgcggtgatttctattgcgaccatg
tttgtttcaacaccaatagggttgttagtgatgcgcttccttattgggattgtgattggc
gctgactatcctattgcaacttcgatgatcaccgaattttccaataaaaagcaacgtgcc
tttgccgttggatttattgctgctatgtggtatatcggtgcgacatgtgccaatttagtg
ggttatcttttatatgatgtccaagatggctggcgttggatgttaggcagtgcttttatt
ccttgcgttattattctaattggtcgctttgatctccctgaatcaccgctttggttaata
cgccaagggcgtattaaagagtgtaatgaaatgatgatcaaactctttggcgagcctgtg
gtctttgaagcagaagatgctaaaacgacccgttttatcgaattatttaataaacgccac
ttctcatttgtgctctttgttgccgtaatttggacctgccaagtgatcccgatgtttgcc
atttatacctttggccctcaaattgtcggtttattaggatgggatacaggaagaagtgcg
gcattaggcaatgtcgtgatcagcctattttttatgttgggttgtattcctgcgatgttt
tggttaaaccaaacggggcggcgcccactgttaattggtagttttgcgatgatgacttta
gcattattcacgctggggatattcccgaatttaccgattttattcgttatcttagcgttt
gctacctacgcttttttctcgggaggacctggcattttacagtggctttatccgaatgaa
ttatttccaaccgatatccgagcatcggcggtgggggttattatgtcgataagccgtatt
gggacggttatttccacctgtgcgcttcccgcttttattgccacttatgggatcaatacc
acaatgctggtgggggcggctatttctctgtttgggatgatggtatcagtactgtttgca
ccagaaacgaagggattaacgttaaagcagacatcaacgatgcctatgcgacgtggtaaa
taa

DBGET integrated database retrieval system