KEGG   Penaeus vannamei (Pacific white shrimp): 113803050
Entry
113803050         CDS       T06111                                 

Definition
(RefSeq) uncharacterized protein LOC113803050
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Pathway
pvm04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113803050
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113803050
NCBI-ProteinID: XP_027209556
LinkDB
Position
Unknown
AA seq 182 aa
MGEMCVDDIVRDQVMALPSVLNYRIWSSGPRSAPPGLPVRRPQASRLRKNLFGPVDHSEN
LRFVREELEKIAKEDSERWNFDFKTEQPKEGRYEWVAVGEGAAKKSPAPQLTCLTANNVN
VKSVKRLSASPPAKMRQRLCTDYFRLNKATTTTKAKAKSERKTEREIAPSRTPEKRTAVA
IR
NT seq 549 nt   +upstreamnt  +downstreamnt
atgggtgagatgtgcgtggatgacatcgtcagggaccaagtgatggctctgccgagtgtt
ctcaactacaggatctggtcttcagggccaaggagtgcgccccccggcctgcccgtcagg
cgaccccaggcgagcaggttgaggaagaacttgttcggccccgtcgaccacagcgagaac
ttgagattcgtgcgcgaggaactcgagaagatcgccaaggaggactccgagcgctggaac
ttcgacttcaagacggagcagcccaaggaaggacgctatgagtgggtggccgttggggaa
ggtgccgcgaagaagagtccggcgccgcagctcacctgcctcactgctaacaacgtcaac
gtcaagtccgtgaagaggctgagcgcgagtccgcccgccaagatgcgacagagactctgc
acggattacttcaggctcaacaaggcgacgacgacgacgaaggccaaggccaagagcgag
cgcaagaccgagagggagatcgccccctcgagaacgccggaaaaaagaaccgcagtggca
atcagataa

DBGET integrated database retrieval system