KEGG   Penaeus vannamei (Pacific white shrimp): 113804020
Entry
113804020         CDS       T06111                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: bcl-2-related ovarian killer protein-like
  KO
K20017  Bcl-2 family protein
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 113804020
NCBI-ProteinID: XP_027210649
LinkDB
Position
Unknown
AA seq 273 aa
MSTDLSREDAELPSGPLILEPYLPPRYARVAHLESYSYMFAPPIAERSNKPAPLPLPPPP
DDGFSNVSDVVTRKISTTIGWHAASGQKRXGHAGKCLATQYIRSRLKRAGLLHKKLGLQR
LRSVATPRAEWEVCEVFPRVSGIGQELERTHPKLYNSVARQLSITLTSDKVVRWVLVQVA
HHVFRGEVNWARIISLFAVAAGLASDCVKQGHPEYVAGVIDVMGIVTERHTAPWIASQGG
WAQRGKPAAEACPEFELAVTLLLTWEADGVATH
NT seq 822 nt   +upstreamnt  +downstreamnt
atgtccactgatttatcaagagaggatgcagagcttccatcaggtcccttgattcttgaa
ccctatttgccgccgagatatgcgcgagtagctcatctggagtcatactcttatatgttc
gcaccacccatcgccgaacggagtaacaaaccagcccctctccccctcccccccccgcca
gacgacggtttcagcaacgtgagtgacgtcgtgacgcgcaagatctcgacgacgatcggc
tggcacgcagcgtccgggcagaagcggnntggtcacgcaggcaagtgtctcgccacgcag
tacatccggtcgagactgaagcgcgcgggcctcctgcacaagaagctggggctccaacgg
cttcgctccgtggcaacacctcgcgcggaatgggaggtgtgcgaggtgttcccccgcgtg
tcaggaatcggacaggaactcgagcgcacgcatcctaaactctacaactcggtggcacga
cagctgtcaatcaccctcacatcagacaaggtcgtgaggtgggttttagtgcaggtggcc
caccatgtcttccgaggcgaggtcaactgggccaggattatctccctgttcgctgtggcc
gccgggttagcctccgactgtgtcaagcaagggcacccggagtacgtggcgggtgtcatc
gacgtcatgggcatcgtcacggagcgccacacggccccgtggatagcctcgcaaggggga
tgggcgcagcgagggaaaccagcggcagaagcgtgccccgagttcgagctggcggtgact
ctgcttctcacgtgggaggcggacggcgttgccacacactga

DBGET integrated database retrieval system