KEGG   Penaeus vannamei (Pacific white shrimp): 113815120Help
Entry
113815120         CDS       T06111                                 

Definition
(RefSeq) actin, muscle-like
  KO
K05692  actin beta/gamma 1
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Pathway
pvm04145  Phagosome
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113815120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pvm03021]
    113815120
   03019 Messenger RNA biogenesis [BR:pvm03019]
    113815120
   03036 Chromosome and associated proteins [BR:pvm03036]
    113815120
   03029 Mitochondrial biogenesis [BR:pvm03029]
    113815120
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pvm04812]
    113815120
   04147 Exosome [BR:pvm04147]
    113815120
Transcription machinery [BR:pvm03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     113815120
Messenger RNA biogenesis [BR:pvm03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     113815120
Chromosome and associated proteins [BR:pvm03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     113815120
    NuA4 complex
     113815120
  Chromatin remodeling factors
   BAF complex
    113815120
   PBAF complex
    113815120
   SWR1 complex
    113815120
Mitochondrial biogenesis [BR:pvm03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    113815120
Cytoskeleton proteins [BR:pvm04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     113815120
Exosome [BR:pvm04147]
 Exosomal proteins
  Proteins found in most exosomes
   113815120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 113815120
NCBI-ProteinID: XP_027223012
LinkDB All DBs
Position
Unknown
AA seq 376 aa AA seqDB search
MCDDDVSPLVVDNGSGMVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDAYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEESPVLLTEAPLNPKANREKM
TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDTGDGVTHTVPIYEGYALPHAILRLD
LAGRDLTAYLMKIMTERGYSFTTTAEREIVRDIKEKLCYVALDFESEMNVAAASSSLEKS
YELPDGQVITIGNERFRCPESLFQPSFLGMESVGIHETVYNSIMRCDIDIRKDLFANNVL
SGGTTMYPGIADRMQKEITALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQSMWITK
EEYDESGPGIVHRKCF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacgacgacgtaagcccccttgtggttgacaatggctccggcatggtcaaggcc
ggattcgccggagacgacgcccctcgtgccgtcttcccctccatcgtcggccgcccccgt
catcagggtgtgatggtcggcatgggtcagaaggacgcctacgtcggcgatgaggcccag
agcaagagaggtatcctgactctcaagtaccccatcgagcacggtatcatcaccaactgg
gacgacatggagaagatctggcatcactccttctacaacgaactccgtgttgctcctgag
gaatctcccgtcctcctcactgaggctcccctcaaccccaaggccaaccgtgagaagatg
acccagatcatgttcgagaccttcaacacacccgccatgtacgtggccatccaggccgtg
ctgtccctctacgcctctggtcgtaccactggtattgtgctcgacactggtgatggtgtg
acccacaccgtccccatctacgaaggttatgctcttcctcatgctatccttcgtctcgac
ttggctggtcgtgacctgactgcttacctgatgaagatcatgactgagcgtggctactcc
ttcaccaccaccgctgaacgagaaatcgttcgtgacatcaaggagaagctttgctacgtc
gcccttgacttcgagagtgagatgaacgtcgctgctgcttcctcatccctcgagaagtcc
tatgaacttcccgacggtcaggtcatcaccatcggtaacgagcgtttccgttgccccgag
tctcttttccagccttccttcctgggtatggaatctgtcggtatccacgagaccgtgtac
aactccatcatgaggtgcgacattgatatcaggaaggacctgttcgccaacaatgtgctt
tctggtggtaccaccatgtaccctggtattgctgaccgcatgcagaaggaaatcactgcc
ttggctccttccaccatcaagatcaagattattgctcctcccgagcgtaaatactccgta
tggatcggtggttccatcctggcttccctgtccaccttccagtccatgtggatcaccaag
gaggaatacgacgaatccggccctggcattgtccaccgcaagtgcttctaa

DBGET integrated database retrieval system