KEGG   Penaeus vannamei (Pacific white shrimp): 113823021Help
Entry
113823021         CDS       T06111                                 

Definition
(RefSeq) uncharacterized protein LOC113823021
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Pathway
pvm03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    113823021
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pvm03400]
    113823021
Enzymes [BR:pvm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     113823021
DNA repair and recombination proteins [BR:pvm03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     113823021
 Prokaryotic type
     113823021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 113823021
NCBI-ProteinID: XP_027231417
LinkDB All DBs
Position
Unknown
AA seq 347 aa AA seqDB search
MITRLSRLLRKNLIFGPSNNSPPPLFAHRREMATQKLIANFFKPVNKRVSGETQDTQVAK
KPKIAEEKENAEEGNNAPGSPTRSSAPELNTCLSPEQKDRMQKNKLKAEIKQTSRKFGAL
HENIGTSWFSALKTEFSKPYFEKLSLFLDGERKRSTIFPPAEQVYSWTHHCELRDVKVVI
LGQDPYHGPRQAHGLCFSVQKGVPPPPSLLNMYKELESDIEGFERPSHGHLIGWAKQGVL
LLNACLSVRAHNANSHKDQGWEKFTDSVIKAVSDRNKGVVFLLWGSYAQKKAAVVDKKKH
HLLNTTHPSPLSAHRGFLGCKHFSKCNEILKKQGKKPIDWNYLPLEM
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccagactctctcgcctccttcgcaaaaacctaattttcggcccaagcaataac
tccccgccgcccttattcgcgcacaggagagaaatggcgacgcagaagctgatcgccaac
tttttcaagccggtcaacaagcgtgtgagcggagagacgcaggatacgcaggtggcaaag
aagccgaagattgcggaagaaaaggagaatgctgaggaaggcaacaatgctccaggctct
ccaacaagatcatcggcacctgagttgaacacctgcctcagtccagagcagaaagaccgc
atgcaaaagaacaagttaaaggctgagataaagcagacaagcagaaaatttggggctctc
catgagaatattggaacaagttggttttctgctttgaagactgagttttctaaaccttat
tttgagaagcttagccttttcctggatggcgagcgcaagaggtccacgatctttcctcca
gccgaacaagtatattcctggacacaccactgcgagctgcgtgatgtgaaagtagttatc
ttaggccaggatccataccatgggccaaggcaagctcatggtctctgctttagtgtgcag
aagggcgtaccaccacctccaagtttgttgaacatgtacaaagagcttgaatcagatatt
gaaggctttgagcggccttctcatgggcatctaattggctgggcaaaacaaggcgttctg
ctcctcaacgcttgcctgtcagtccgtgcccacaatgctaattcacacaaagaccaaggc
tgggagaagttcacagactcggttatcaaggcagtgtcggatcgcaacaagggcgtcgtg
tttctcctgtggggttcttatgcacagaaaaaagctgctgttgtagataagaaaaaacac
cacctcttgaacacaactcacccgtcgcctctgtcagctcatcgaggtttcttgggatgc
aagcacttctcgaagtgtaatgaaattctcaaaaaacaaggcaagaagcccattgactgg
aattacttgcctctagaaatgtaa

DBGET integrated database retrieval system