KEGG   Penaeus vannamei (Pacific white shrimp): 113827313
Entry
113827313         CDS       T06111                                 

Definition
(RefSeq) uncharacterized protein LOC113827313
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Pathway
pvm04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    113827313
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 113827313
NCBI-ProteinID: XP_027236007
LinkDB
Position
Unknown
AA seq 172 aa
MGELCVEGIRRNQIMALPSVLNYRIWSSTGPRSLPSLARRGPSTKLRKSLFGPVDHAENL
RFVREELDKISREDSERWNFDFAAEEPQEGRYEWKTVGEVTPEAKKSSPLTCLTNKKQVK
RLQTDLPANMKQRLCTDYFRKTSHKTQRTVPKVKDSVLSSSNKMNITKSSKV
NT seq 519 nt   +upstreamnt  +downstreamnt
atgggtgagctgtgtgtcgaaggcatcaggagaaaccagatcatggctttgccgagtgtc
ctgaactacagaatctggtcctccacggggcctcgaagcctgccgagcctggccaggcga
gggccaagcaccaagctgcggaagagcctgttcggccccgtcgaccacgccgagaacctg
cgattcgtgcgcgaggagctggacaagatctcgcgagaggactccgagcggtggaacttc
gacttcgcggcggaggagccccaggagggacgctacgagtggaagaccgttggcgaagtg
acacctgaggcgaagaagtcaagcccactcacttgcctcacgaacaagaagcaagtgaaa
cgattgcagaccgacttaccggccaacatgaagcaaagactgtgcaccgactatttcaga
aaaacctcgcacaagacccagagaacggtgcccaaagtgaaggacagtgttctcagcagt
tctaataaaatgaacatcacaaaatccagcaaagtttga

DBGET integrated database retrieval system