KEGG   Paenibacillus vortex: PVOR_06615Help
Entry
PVOR_06615        CDS       T05385                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pvo  Paenibacillus vortex
Brite
Enzymes [BR:pvo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PVOR_06615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: EFU42883
UniProt: A0A2R9SZV3
LinkDB All DBs
Position
complement(166304..167473)
AA seq 389 aa AA seqDB search
MLFHYGAKLPVRLLEEIRYWKHQERKHTGLIKAVVPDLEPVYVQMLDQWALVFADTEKVA
DELLRHILSNHAPPSPQVLAQVEQLLRASCEQSREFIRQLHGLKENSEAVQKVPLAGTVV
HHVIRESEYFLNALETLNSAGALERFMDMPQQSMTLHEASSPPPSLSEAELSIQGMGDSG
QAVPIGGHRLPPLPYAYDALEPYIDEKTMRIHHDIHHKSYVDGLNKAEKKLEEARKSGDF
ELVKHWERELAFNGAGHYLHTIFWNIMNPRGGGEPGGELAQQIKNYFGSFDRFKNQFTEA
ADKVEGGGWAILVWSPRSHRLEILQAEKHQNLSQWDVVPLLTLDVWEHAYYLKHQNKRKD
YINDWWKVVYWPEVADRFKHASKLKWKPF
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgttatttcattatggagcgaaactcccggtacgattattggaggaaattcgctattgg
aaacatcaggaaaggaaacataccgggctgattaaagccgtagttcctgatctggaaccg
gtctacgttcagatgctggatcagtgggccctcgtatttgccgatacagaaaaagtcgct
gacgaacttctgcgccacattctcagcaaccatgcgcctccttcacctcaagtgctggcc
caggtagagcagctgcttcgagcctcctgcgagcaatccagagagttcatccgccagctg
cacggactgaaggagaatagcgaagccgttcagaaggtaccgcttgccggtacggttgta
catcacgtcatccgggagtccgagtatttcctgaacgcactggagaccctcaactccgct
ggagcattggagcgattcatggatatgccgcaacaatccatgacgcttcatgaggcctcg
tcccctccaccatctctctcagaggctgagctatccattcaaggcatgggcgacagcggt
caggccgtcccgattggtggacaccgcctcccccctctcccttacgcttatgatgcgctt
gagccttacattgatgaaaagacaatgcggattcatcatgacattcaccataagagctat
gtcgacggcttgaacaaagcggagaagaaattggaggaagcccgaaaaagcggagatttc
gaactcgtgaaacattgggaacgcgagctagccttcaatggtgccggccattatctgcac
acgatcttctggaatattatgaaccctcggggcggcggcgaaccgggcggggagcttgcc
cagcaaatcaagaattatttcggcagcttcgatcgctttaagaatcaatttaccgaagca
gcagacaaggtggaaggcggcggctgggccatcctcgtctggagcccgcgcagccatcgg
cttgaaattttacaggctgagaaacaccagaacctgtcccaatgggatgtcgtccctctc
ctcaccctggatgtatgggagcatgcctattacctcaaacatcagaataaacggaaagat
tacattaacgactggtggaaagtggtctactggccagaggttgcggatcgcttcaaacat
gccagcaagttaaaatggaagccgttctaa

DBGET integrated database retrieval system