KEGG   Paenibacillus vortex: PVOR_20094Help
Entry
PVOR_20094        CDS       T05385                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
pvo  Paenibacillus vortex
Pathway
pvo00627  Aminobenzoate degradation
pvo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pvo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PVOR_20094
Enzymes [BR:pvo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     PVOR_20094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: EFU40433
UniProt: A0A2R9SSU3
LinkDB All DBs
Position
complement(137139..138593)
AA seq 484 aa AA seqDB search
MDYLQLGKQFIDGEWRDGSSSITLPDINPYNDEVITAFQIASVADIDAAYQAACKAQLEW
DKVNPYNKRDILENAVKYIEVNEEEITSIIVQELGGTRLKAAFEIGLVKNIIKEAATFPL
RMEGKILPSVENGKENRLYRMPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHED
SPITGGTLIGKIFEEAGVPKGLLNVVVTDIKEIGDAFVEHPIPRIISFTGSTKVGSYIGQ
LAVKNFKKPLLELGGNSAFIIMEDADIDYAVQAATFSRFTHQGQICMSANRILVQKTIYQ
EFIDKFGAKVSTLTTGDPSDPQTILGPVINNRQAETLQQLIAQGIEQGAVPLLKGQITGR
MVEPTILIDVKPDMVVAQEELFGPVVCIIPFETEAEAIEIANHSRFGLSGAIHTSNLERG
VEMAKKIHTGMIHVNDVTINDEPIVAFGGEKQSGLGRLNGAWSLDEFTTMKWISVHYGQR
KFPY
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggactatttacagttaggaaagcaattcatagacggggaatggagagatggtagtagc
agtataacgctgcctgatatcaatccttataatgatgaggtaatcaccgcatttcaaatc
gccagcgttgcagacattgatgctgcttatcaagcggcctgtaaagctcagctggaatgg
gacaaggttaatccttacaataaacgcgatatccttgagaatgccgttaaatatattgaa
gtgaatgaggaagagattacgtccattattgttcaggagctgggcggaacgcggctgaag
gccgcatttgaaatcggtcttgtgaaaaacatcataaaggaagcagctacattccctctt
agaatggagggtaagattctgccttctgtagagaacggcaaggagaaccggctgtaccgt
atgcccgctggcgtagttggggtgatcagtccgtttaacttccctttcttcctgtccatg
aaatcagttgcaccggcgctgggtgctggcaatggagtggtactgaaaccgcacgaggat
tcacctattacgggtggaactctgattggcaagatttttgaggaagccggtgtaccgaag
ggcctgttgaacgtagtggtgacagatatcaaggagatcggcgatgcgtttgttgagcat
ccgatcccgagaatcatttccttcacgggttccactaaggttgggagctatattggacaa
ttggctgtcaagaatttcaaaaaaccgctgctggagcttgggggaaatagcgcgttcatt
attatggaggatgcggatatcgactacgcggtgcaagcggcgacattcagcagattcacg
caccaaggtcagatttgcatgtcggccaaccgaattctggtacagaagacgatctatcag
gaatttatcgataaattcggagcgaaggtctctacgcttacaacaggtgacccgagtgat
cctcagaccatccttggacccgtcatcaacaaccgtcaggcagagacactgcagcagctg
attgcacagggcattgagcaaggggcggttccgctgttgaaaggtcagattacgggcaga
atggtggagcctaccatcctcatagacgtcaaaccggatatggtggtagcgcaagaggag
ctgtttggcccggttgtgtgtatcattccgttcgaaacagaagcagaagctattgaaatt
gccaaccattcacgttttgggcttagcggggctattcatacctccaatctggagcgtggg
gtagagatggcgaagaaaatccacaccggtatgatccatgtgaatgatgtcacgattaac
gacgagccgattgttgcttttgggggagagaaacagtccgggctgggccgcttgaatggg
gcatggagcctggatgaattcaccacgatgaagtggatatcggttcattacggacaaagg
aaattcccgtactaa

DBGET integrated database retrieval system