KEGG   Paenibacillus vortex: PVOR_21339Help
Entry
PVOR_21339        CDS       T05385                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
pvo  Paenibacillus vortex
Pathway
pvo00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pvo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PVOR_21339
Enzymes [BR:pvo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PVOR_21339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: EFU39871
UniProt: A0A2R9SRA8
LinkDB All DBs
Position
complement(269057..270820)
AA seq 587 aa AA seqDB search
MQPQLKAINQQFVLGDEPIQILSGAVHYFRIVPEYWEDRLMKLKACGFNTVETYIPWNLH
EPKEGQFTFDGIADLEGFVQKAGHLGLHVILRPSPYICAEWEFGGLPAWLLQYPDIHLRC
MDPVYLEKVDHYYDELIPRIVPLLTSKGGPVIAIQIENEYGSYGNDTAYLEYLKDGLSAR
GVDVLLFTSDGPTDGMLQGGTVPNVLATVNFGSRPGEAFAKLREYRTEDPLMCMEYWNGW
FDHWLKPHHTRSSEEVAQVFEEMLRLNASVNFYMFHGGTNFGFYNGANDQEKYEPTVTSY
DYDAPLSECGDATAKYEAVRSAIVKHQGLEIADLPNLPQPSVKKSYGSVRMTHYADLLEQ
LPVLSEQVKRTTPVPMELLGQSYGFIVYSTVVSGPRQGEFLHLQEVHDRAQVFLNGIYQG
TVERWNPQALQLDIPAAGAKLEIVVENMGRVNYGPKLKDYKGITEGARMNNQFLFDWSIY
PLPLENPNTASFQALEGALDQQDRPTFYTGEFTVDEIGDTFIRLDGWGKGVVWINGFNLG
RYWKEGPQATLYVPGPLLKQGRNAITVFELHHSGDACVHLVDKPDLG
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctcaattgaaagcgataaatcaacagttcgtgttaggggatgaaccgattcag
attctgtcaggtgctgttcactattttcgtatcgttccggaatattgggaagaccggttg
atgaagcttaaagcgtgtgggttcaacaccgtggagacctatattccgtggaatttgcat
gagcccaaggaagggcaatttacgtttgatggcatagctgacttggaaggatttgtccaa
aaagccggtcatctggggctgcacgtgatcctgcggccaagtccttatatatgtgcagaa
tgggaattcggcgggcttcctgcctggctgctgcagtatccggatattcatctgcgatgt
atggaccccgtctatttggagaaggttgaccactattacgatgaactgattccacgaata
gttccgctgctgacctccaagggaggtccggtaattgcgattcagattgagaatgagtac
ggcagttatggaaatgatacggcctatctggaatatttaaaagacggcttgtccgcgcgt
ggcgtggatgtattgctgttcacttcagatggtcctacggatggcatgctgcagggggga
accgtaccgaacgtgcttgcaaccgtcaatttcggatccagacccggggaagccttcgct
aaactgcgagagtaccggacagaagatcctcttatgtgtatggaatactggaacggatgg
tttgatcattggttgaaaccgcatcatacgcggagctccgaggaggttgcccaggtattc
gaggagatgcttcgtctgaatgcatccgtgaatttttacatgtttcatggcggaacgaat
ttcggattctacaacggagcgaatgatcaagaaaagtatgaaccgacagtcaccagctat
gattatgatgctcctctctcggaatgcggggatgcaaccgctaaatatgaggccgttcgc
agtgcgattgttaagcatcaggggcttgagattgcggatctgcccaatctgcctcagcct
tcggtgaagaaaagttatggctctgttcgcatgacgcattatgccgacttactggagcag
ttgccggtactgtcggagcaggtgaaacgcacaacgcctgttcctatggagttgttgggt
caaagttatgggttcattgtgtattcaacggtggtttcgggtccacgtcagggtgaattc
ttgcatctgcaagaggtgcatgaccgggcgcaggtattcttgaatggtatttatcagggt
accgttgagcgctggaatcctcaagccttgcagctcgatattccggcagccggggcgaag
ctggagattgttgtcgagaatatggggcgggttaactatggtccgaaactgaaggactat
aagggcatcacggagggagctcggatgaacaaccagttcctgttcgactggagcatctat
ccgctgccgttagagaatccgaatacggcatcgttccaagcgctggaaggtgcattggat
cagcaggatcggcctaccttctataccggcgaattcacggttgatgaaatcggtgataca
ttcattcgtctggatggatggggaaaaggcgtagtatggatcaatggcttcaatctggga
cgctattggaaggaagggccgcaggcaacactttatgtgcctggaccgctgctgaagcag
ggtcgcaatgcaatcacggtatttgaactgcatcattccggcgatgcgtgcgtccatctt
gttgataagcccgatctgggctga

DBGET integrated database retrieval system