KEGG   Paenibacillus vortex: PVOR_28769Help
Entry
PVOR_28769        CDS       T05385                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pvo  Paenibacillus vortex
Pathway
pvo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pvo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PVOR_28769
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pvo03400]
    PVOR_28769
Enzymes [BR:pvo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PVOR_28769
DNA repair and recombination proteins [BR:pvo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PVOR_28769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: EFU38605
UniProt: A0A2R9SMN1
LinkDB All DBs
Position
17543..18448
AA seq 301 aa AA seqDB search
MGQLQNMLPKEPMAPISTEQITTGEEWGYQLKWDGVRILAGVDPSGVSLYSRKLLDKTSL
YPEVVQALSGLNERRLLLDGEVVYFHPELGRPVFQKVLQRERSRAISTHAPLFTYVLFDI
LVDGDQDLRKLPYLERHHRLKEAVSATPGLLIADLFLEGEHLWNWAEERGWEGIVMKRLS
SPYREGKKHRDWYKKKIAVNMKATAVGLIMREGRVASLVIADDEGSYIGRASLGLNEQTK
KKLLQYAESHQAGAAWHALHNDLKKEQLAWLSQPLTVQVTFLEWSQDGMMRHPKLVSIEG
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggacagctgcagaatatgctgcctaaggagccaatggccccaatctcgacggaacag
atcaccacgggtgaggagtggggataccaattgaaatgggacggcgtgcgaattctggcc
ggagtagaccctagcggcgtatctctgtactcccgtaagctgttggataaaacctccctg
tatcccgaagtcgttcaggcattatccgggctgaatgaacggcgtcttctcctggatggt
gaggttgtctactttcatccggaattaggtcgacccgtgttccagaaggttctccagcgg
gagcgatcgcgtgccatcagcacgcacgctcctctgttcacgtatgtcttgttcgacatt
ctggtggacggcgatcaggacctgcgcaagcttccttatcttgaacgccatcaccggctg
aaggaagccgtttccgccacgccgggtcttctgatcgcagatctgtttcttgagggcgag
catttatggaattgggccgaggaacgaggctgggaaggcattgtaatgaagcgcctcagc
tctccatatcgcgaaggcaagaagcatcgggattggtacaaaaagaaaattgccgttaac
atgaaagccacggctgttggactcatcatgagggagggccgcgtagccagcctggttatt
gccgatgacgagggcagctatatcggcagagcatccctcgggcttaatgaacagaccaaa
aaaaagctgctgcagtatgcggaaagccaccaggctggggccgcttggcacgcactccat
aatgacctgaaaaaagaacagcttgcctggctcagtcagccgctgacggtgcaggttaca
tttctcgagtggagtcaggacggcatgatgcgccatcccaaacttgtctcgattgagggg
gtgtaa

DBGET integrated database retrieval system