KEGG   Paenibacillus vortex: PVOR_29843Help
Entry
PVOR_29843        CDS       T05385                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pvo  Paenibacillus vortex
Pathway
pvo00970  Aminoacyl-tRNA biosynthesis
pvo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PVOR_29843
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pvo03029]
    PVOR_29843
Enzymes [BR:pvo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PVOR_29843
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PVOR_29843
Mitochondrial biogenesis [BR:pvo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PVOR_29843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey ApbA_C
Motif
Other DBs
NCBI-ProteinID: EFU38510
UniProt: A0A2R9SMC5
LinkDB All DBs
Position
complement(7826..9265)
AA seq 479 aa AA seqDB search
MSTSKYETVIGLEVHVELHTNSKIFCGCSTAFGAPPNTHTCPICLGHPGVLPVLNRQAVE
YAMKAAMALNCTIGDVSKFDRKNYFYPDSPKAYQISQYDQPIGLNGWIDIEVDGKTKRIG
ITRLHLEEDAGKLTHVDGGYASLVDFNRVGTPLVEIVSEPEISTPEEAKAYLEKMRAIMQ
YCDVSDVKMEEGSLRCDANISLRPWGQKELGTKAELKNMNSFRGVQRGLEYEQFRQAETL
DEGGVIVQETRRWDEAQAKTFSMRGKEQAHDYRYFPDPDLVTVHISEEWKESVRATIPEL
PDARKARYASEYGLPDYDAAVITSSKLLADFFEDSLNYTKDAKSVSNWIMGDLLGYLNSG
NLELSDVKISGQGLGEMIGLIEKGTISSKIAKTVFKEMLESGKLPAGIVEEKGLVQISDE
GAIKSIVEQVVANNPQSVEDYKAGKQKAIGFLVGQVMKESKGKANPALANKLLVEVLNG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatcgaaatatgaaacggttatcggattggaagtgcacgtagagctgcatacg
aattccaaaatattttgcggttgctccacggcgttcggagcaccgccgaacacacataca
tgtcccatttgccttggccatcccggcgtactgcctgtattaaaccgccaggcggtggaa
tatgcgatgaaagcagccatggcgctgaattgcaccatcggcgatgtcagcaaatttgat
cgcaagaactacttctacccggattcgcccaaagcgtatcaaatttctcaatacgatcag
ccgatcggtttaaacggctggattgacattgaggtagacgggaagacgaagcggattggc
attacccggcttcatctggaagaagatgcgggtaagctaactcatgttgacggcggatat
gcctcgctggttgactttaaccgggtaggaacaccgcttgttgagatcgtatccgagcct
gagatctcaacgcctgaggaagccaaagcttatctggagaagatgcgtgcgattatgcaa
tattgtgatgtctcggacgtgaagatggaagagggctcgcttcgctgtgacgccaatatc
agtcttcgtccatggggacagaaggaactgggaaccaaagcggaactgaagaacatgaac
tccttccgcggtgtgcagcgcggcttggaatatgagcagttccggcaggcggaaacgctg
gatgaaggcggtgtaatcgttcaggaaacccgccgctgggatgaagcgcaggccaaaacc
ttctcgatgcgcggcaaggaacaggcgcatgactatcgctatttcccggacccggatctg
gtaacggtgcatattagcgaagaatggaaggagtcggttcgtgcaacgattccggagctt
ccggatgctcgtaaggcacgttatgcttcggaatatggtttgccggactatgatgctgcg
gtgatcacgtcgtccaagctgctggcagacttttttgaggacagcttaaactataccaag
gatgctaaatccgtatccaattggatcatgggtgatttgctgggttacttgaactcgggc
aatctggagctgtccgatgtgaagatctcgggtcaaggcttaggcgagatgatcggattg
atcgagaagggtaccatcagcagcaaaatcgccaaaaccgtcttcaaagagatgctggag
agcggcaagctgcctgctggaatcgttgaggagaagggactcgtccaaattagcgatgaa
ggtgccatcaagagcattgtcgagcaggttgtcgcgaacaatccgcaatccgttgaggat
tataaggcaggtaaacagaaagcgatcggcttcctggttgggcaagtaatgaaagagagc
aagggtaaagccaatcctgctctggcgaataaactgctggttgaggtactgaacggataa

DBGET integrated database retrieval system