KEGG   Pseudomonas veronii: PverR02_00975Help
Entry
PverR02_00975     CDS       T04853                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pvr  Pseudomonas veronii
Pathway
pvr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PverR02_00975
Enzymes [BR:pvr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PverR02_00975
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PverR02_00975
    1.1.1.-  
     PverR02_00975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C DAO 2-Hacid_dh_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AQY63672
LinkDB All DBs
Position
215012..216106
Genome map
AA seq 364 aa AA seqDB search
MTLSINPQRSMRAAVWHGRHDIRVEDVPLPISPPAGWVQIRVQWCGICGSDLHEYVAGPV
FIPVDAPHPLTGIKGQCILGHEFCGEIVELGAGVQGFSVGEPVAADACQHCGTCYYCTHG
MYNICENLAFTGLMNNGAFAELVNVPANLLYKLPANFPAEAGALIEPLAVGMHAVKKAGS
LLGQNVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSGARKTKAREVGATHVLDPNECDAL
AEVRRLTGGLGADVSFECIGNKHTAKLAIDLVRKAGKCVLVGIFEEPSEFNFFELVATEK
QVMGALAYNGEFADVIAFIADGRLDITPLVTGRIQLEQIVGQGFEELVKNKEHNVKIIVS
PARV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttcgatcaatccgcaacgcagcatgcgcgccgctgtctggcacggccgtcac
gatatccgcgtcgaagacgtcccgctgcccatttcgccgccggccggttgggtgcagatc
cgcgtgcagtggtgcggaatctgcgggtccgacttgcatgagtacgtggccgggccggtg
ttcataccggtcgacgccccgcacccgctgaccgggataaaggggcagtgcatcctcggg
catgagttttgtggcgagatcgtcgaactcggcgccggcgtgcagggcttcagcgtcggc
gagccggtggcggccgatgcgtgccagcattgcggcacgtgctactactgcacccacggg
atgtacaacatctgcgagaacctggccttcaccgggctgatgaacaatggtgccttcgcc
gaactggtcaacgtgcccgccaacctgctgtacaaattgccggcgaattttcccgctgaa
gccggggcactgatcgagccgctggcggtgggcatgcacgcagtgaaaaaagccggaagc
ctgctcgggcaaaacgtagtggtggtcggtgccggcaccatcggcctgtgtaccatcatg
tgcgccaaggcggccggtgcggcgcaggtgatcgcgctggaaatgtccggcgcccgcaag
accaaggcccgggaagtgggcgcgacccatgtgctcgatcccaatgagtgcgacgccctg
gccgaagtccgccgcctcacgggcgggctcggtgcggatgtcagtttcgaatgcatcggt
aacaaacacacggccaaactcgcaatcgacctggtccgcaaggccggcaagtgcgtcctg
gtggggatcttcgaggagcccagcgagttcaactttttcgaattggtggcgacggaaaaa
caggtaatgggcgcgctggcctataacggcgagttcgctgacgtgatcgcgtttatcgcc
gatggacggctggacattacgccgctggtgacggggcgtatccagttggaacagatcgtg
gggcagggctttgaggagttggtcaagaataaggagcacaacgtgaaaatcattgtgtcg
cctgctcgggtctga

DBGET integrated database retrieval system