KEGG   Pseudomonas veronii: PverR02_05025Help
Entry
PverR02_05025     CDS       T04853                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pvr  Pseudomonas veronii
Pathway
pvr00473  D-Alanine metabolism
pvr00550  Peptidoglycan biosynthesis
pvr01100  Metabolic pathways
pvr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pvr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PverR02_05025
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PverR02_05025
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PverR02_05025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pvr01011]
    PverR02_05025
Enzymes [BR:pvr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PverR02_05025
Peptidoglycan biosynthesis and degradation proteins [BR:pvr01011]
 Precursor biosynthesis
  Amino acid ligase
   PverR02_05025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATP-grasp_5 ATPgrasp_YheCD TTL ATPgrasp_Ter GARS_A
Motif
Other DBs
NCBI-ProteinID: AQY64434
UniProt: A0A0R3B9J4
LinkDB All DBs
Position
1116351..1117319
Genome map
AA seq 322 aa AA seqDB search
MTTNYASLFSTIAPADFGRVAVLFGGKSAEREVSLKSGNAVLEALQSAGVNAFGIDVGDD
FLARLQAEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHSVLCSEDDCISAAKELGLPLIVKPAHEGSSIGMAKVNSAAELIDAWKAAST
YDSQVLVEQWIQGPEYTIATLRGQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLDAS
KEQELMDLTAKACEALGIAGWARADVMQDDQGNFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASVAGEERQRG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaactacgcctccctgttctccaccatcgcccctgccgacttcggccgcgtg
gccgtgctgttcggcggtaagagcgctgagcgtgaagtgtcgctcaagtccggcaacgcc
gtgctcgaagcgctgcaaagcgcgggcgtgaatgcgttcgggatcgacgtgggtgacgac
ttcctcgcacgcctgcaggccgagaagatcgaccgcgccttcatcatcctgcacggccgt
ggtggtgaagacggcagcatgcaaggcctgctggagtgtgccgggattccttacaccggc
agcggcatcctcgcctcggcgctggccatggacaagttgcgcaccaagcaggtgtggcac
agcctgggaattcctaccccgcgtcacagtgtgctgtgcagcgaagacgattgtatttct
gcagccaaggaactgggcctgcctttgatcgtcaaaccagcccatgaaggctccagtatc
ggcatggctaaagtgaactcggccgccgaattgatcgacgcatggaaagcggcaagtacc
tacgattcgcaagtgttggtggaacagtggatccaaggtcccgagtacaccatcgccacc
ctgcgtggccaggtattgccgcccatcgccttgggcacgccccacaccttttacgattac
gacgccaagtacctggcttccgatacccagtaccggatcccctgcggccttgacgcaagc
aaagaacaggaattgatggacctcacggcgaaagcctgtgaggcgctgggtatcgccggt
tgggcgcgggcagacgtgatgcaggacgaccaagggaatttctggttcctggaagtcaac
accgcaccgggcatgaccgaccacagcctggtccctatggccgcgcgcgcagccggcctg
gatttccagcagttggtgctggcgatcctggcggccagcgttgccggtgaagaaaggcag
cgaggctaa

DBGET integrated database retrieval system