KEGG   Pseudomonas veronii: PverR02_07915Help
Entry
PverR02_07915     CDS       T04853                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pvr  Pseudomonas veronii
Pathway
pvr00071  Fatty acid degradation
pvr00280  Valine, leucine and isoleucine degradation
pvr00281  Geraniol degradation
pvr00310  Lysine degradation
pvr00362  Benzoate degradation
pvr00380  Tryptophan metabolism
pvr00410  beta-Alanine metabolism
pvr00640  Propanoate metabolism
pvr00650  Butanoate metabolism
pvr00903  Limonene and pinene degradation
pvr00930  Caprolactam degradation
pvr01100  Metabolic pathways
pvr01110  Biosynthesis of secondary metabolites
pvr01120  Microbial metabolism in diverse environments
pvr01130  Biosynthesis of antibiotics
pvr01200  Carbon metabolism
pvr01212  Fatty acid metabolism
Module
pvr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PverR02_07915
   00650 Butanoate metabolism
    PverR02_07915
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PverR02_07915
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PverR02_07915
   00310 Lysine degradation
    PverR02_07915
   00380 Tryptophan metabolism
    PverR02_07915
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PverR02_07915
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PverR02_07915
   00281 Geraniol degradation
    PverR02_07915
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PverR02_07915
   00930 Caprolactam degradation
    PverR02_07915
Enzymes [BR:pvr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PverR02_07915
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PverR02_07915
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PverR02_07915
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PverR02_07915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AQY64993
UniProt: A0A3S0UHR1
LinkDB All DBs
Position
1740705..1742852
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIKADASVKGVIVSS
GKDVFIVGADITEFVESFKLPDAELVAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLE
MCLAADFRVMSATAKIGLPEVKLGIYPGFGGTVRLPRIIGADNAIEWIAAGKENKAEDAL
KVGAVDAVVAPDKLAEAALNLIKGAISGEFDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSAARSLIGLFLNDQEL
KKKAKAYDEVAKDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKL
LVGRVDKGRMTAAKMAEVLNGIRPTLSYGDFGHVDLVVEAVVENPKVKQAVLAEVEAQVK
DDTILASNTSTISITLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSELAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAIDALYEAKRLGQKNGKGFYAYETDKKGKQ
KKVADPSVHEVLAPVIYEQREVSDEDIINWMMIALCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQSFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgaactg
aaattcgacctcaagggtgagtccgtcaacaagttcaaccgtctaaccctgaacgaactg
cgtcaggccgtagacgccatcaaagcagatgcttcggtcaagggcgtgatcgtctccagc
ggcaaggacgtgtttatcgtcggcgccgacatcaccgaattcgtcgagagcttcaagctg
cccgatgccgagctggtggctggcaacctcgaagccaacaagattttcagcgatttcgaa
gacctcaacgtgccgaccgttgccgcgatcaacggcatcgcgctgggcggcggcctggaa
atgtgcctggccgcggattttcgcgtcatgtcggccactgcgaaaatcggcctgccggaa
gtcaagctgggcatctacccaggtttcggcggcaccgtgcgcctgccgcgcatcatcggg
gccgacaacgccatcgagtggatcgccgccggcaaggaaaacaaagcggaagacgcgctg
aaagtcggtgccgtcgatgccgtggttgccccggacaaactggccgaagccgcgctgaac
ctgatcaagggcgccatcagcggcgaatttgattacaaggccaagcgtcagccgaagctg
gaaaaactcaagctcaacgccatcgaacaaatgatggcgttcgaaaccgccaaaggtttc
gtggctggccaggccggcccgaactacccggcgccggttgaagcgatcaagaccatccag
aaagccgcgaacttcggtcgcgacaaagccctggaagtggaagcggcaggtttcgtcaaa
ctggccaagacctccgctgcccggagcctgatcggcctgttcctgaacgatcaggaactg
aagaaaaaggccaaggcctacgatgaagtcgccaaggatgtgaaacaggccgccgtactc
ggtgccggcatcatgggcggcggtatcgcctatcagtcggcgtccaaaggcacgccgatc
ctgatgaaagacatcaacgaacacggcatcgagcaaggcctggcggaagcggccaagctg
ctggtgggtcgggttgataaaggtcgcatgaccgcggcgaaaatggctgaagtgctcaac
ggcattcgtcctacgctgtcctacggcgatttcggccacgtcgacctggtggtcgaagcg
gttgtcgaaaacccgaaggtcaagcaagcggtactggcggaagtggaagcccaggtcaaa
gacgacaccatcctggcgtccaacacctcgaccatttccatcacgctgctggccaaggcc
ctcaagcgtccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggtgagaagtccagcgagctggccgtcgccaccaccgttgcc
tacgccaagaaaatgggcaagaacccgatcgtggtcaacgactgcccgggctttttggtc
aaccgcgtgctgttcccgtacttcggcggtttcgccaagctggtcagcgccggtgtggac
tttgtgcgtatcgacaaggtcatggaaaaattcggctggccgatgggcccggcgtacctg
atggacgtggtcggcatcgacaccggccaccacggtcgcgacgtgatggctgaaggcttc
ccagaccgcatgaaagacgaccgccgctcggcgatcgacgcgctctacgaggccaagcgc
ctgggccagaagaacggcaagggcttctacgcctacgagaccgacaagaagggcaagcag
aagaaggttgccgatccgtcggtccacgaagtgctcgcgccggtcatctatgaacagcgt
gaggtgtccgacgaggacatcatcaactggatgatgatcgccctctgcctggaaaccgtg
cgttgcctggaagacggcatcgtcgaaaccgccgccgaagccgacatgggcctggtgtac
ggtattggtttccctccattccgtggcggtgcactgcgttacatcgactcgatcggtgtg
gccgagttcgttgccctggctgatcaatacgctgatttgggcccgctgtaccacccgacc
gcgaagctgcgtgagatggccaagaacggccagagcttcttcggttaa

DBGET integrated database retrieval system