KEGG   Pseudomonas veronii: PverR02_13760Help
Entry
PverR02_13760     CDS       T04853                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
pvr  Pseudomonas veronii
Brite
KEGG Orthology (KO) [BR:pvr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PverR02_13760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AQY66065
LinkDB All DBs
Position
3005474..3006259
Genome map
AA seq 261 aa AA seqDB search
MDVGNVGFVVAGLIVGFIVGMTGVGGGSLMTPILLWFGINPATAVGTDLLYAAITKSGGV
LVHGKNKNIDWTITGWLTLGSVPAVLLTLWFLASLHTDPSAMNAVIKQALGVVLLLTALA
ILFKHRLLAFAQRHAGDDYHMHPRNLNALTVVTGAVLGAMVALTSIGAGALGTVALFILY
PFLATRRLVGTEIAHAVPLTLVAGLGHAGMGNMDWHLLGFLLMGSLPGIYIGSHMAGKVP
DGVLRPCLAIMLMSIGYKLAF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgggtaacgttggtttcgtagttgcaggcctgatcgttggttttatcgtcggc
atgaccggtgtcggcgggggctccttgatgaccccgatcctgctgtggttcggcattaac
ccggccaccgccgtgggcaccgacttgttgtacgccgccatcaccaagtccggtggggtg
ctggtgcatggcaaaaacaagaatatcgactggaccatcaccggctggctcaccctgggc
agcgtgcccgcggtgctgctgaccctgtggttcctcgccagcctgcacaccgaccccagc
gcgatgaacgcggtgatcaaacaggcgctcggcgtggtgttgctgctgaccgccctggcg
attctgttcaagcatcgcctgttggccttcgcccagcgccatgccggcgacgattaccac
atgcacccgcgcaacctgaacgcgctgacggtggtcacgggggcggtcctcggcgccatg
gtggcactgacctccatcggcgccggagccctcggcaccgtggcgctgtttatcctttac
ccgttcctcgccacgcggcgcctggtcggcaccgagatcgcccacgccgtacccctgacg
ctggtagcgggcctgggccacgccggcatgggcaatatggattggcacctgctgggcttt
ttgctgatgggatcgctgccgggtatctacatcggtagccacatggccggtaaagtcccg
gacggcgtgctgcgcccgtgtctggcgatcatgttgatgagcatcggttataagctggct
ttctaa

DBGET integrated database retrieval system