KEGG   Pseudomonas veronii: PverR02_16235Help
Entry
PverR02_16235     CDS       T04853                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pvr  Pseudomonas veronii
Brite
KEGG Orthology (KO) [BR:pvr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PverR02_16235
Enzymes [BR:pvr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PverR02_16235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 Thi4 NAD_binding_8 Glutaredoxin FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AQY66528
UniProt: A0A3S0MDU8
LinkDB All DBs
Position
complement(3617049..3618614)
Genome map
AA seq 521 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVTSLTTLITLKTEGDDAR
KPSFSINRPGAEISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRALKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIKHVAIDGALFQAEVDERQVMAVPSVYLNGVNF
GQGRMGLEEILAKLDTSGIEKAAEKISAKAAFDVLVVGGGPAGSAAAIYAARKGIRTGVA
AERFGGQVLDTMSIENFISVQETEGPKLASALEAHVRQYDVDIMNLQRASSLVPAKNAGD
LHEIRFESGATLKSKTVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLFSLPNVDVITSALTSEVKGDG
QKVTGLVYKNRDNGEFTTIGLEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatacctggaacgggtcacccagccg
attgagatcgtcgcctccctcgatgacggcgcgaaatcccaggaaatgcttgcacttttg
caggacgtaaccagcctcaccacgctgattaccctgaaaaccgagggtgacgatgcacgc
aagccctcgttttccatcaaccgcccgggtgccgagatcagcctgcgttttgccggcatc
cccatggggcatgaattcacttcgctggtgttggccctgctgcaagtcggtggccacccg
tcgaaggccagtgtcgaagtgattgaacagattcgcgcgctcaaaggcgagttcagcttc
gagacttacttctcgctgtcatgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctgaacccgaacatcaagcatgtggccatcgacggcgcgctgttccaggcc
gaagtcgatgagcgccaagtcatggccgtgccaagtgtctacctcaacggtgtgaacttc
ggccagggccgcatgggcctggaagaaatcctcgccaagctcgacaccagcggtatcgaa
aaagccgccgagaagatcagtgccaaagcggcattcgatgtgctggtggtcggcggtggc
ccggccggttcggcggcggctatctacgctgcgcgcaaaggtatccgtaccggtgtggcg
gccgagcgttttggcggccaggtgctggacaccatgtccatcgagaactttatctcggta
caggaaaccgaagggccgaaactggccagcgcgcttgaagctcatgtgcgtcagtacgac
gtggacatcatgaacctgcagcgtgccagcagcctggtgccggcgaaaaatgccggtgac
ttgcacgaaatccgttttgaaagcggtgcgacgctcaagtcgaagacggtgatcctggct
accggcgcccgctggcgtgaaatgggcgttccgggcgagcaggaatacaaggccaagggc
gtgtgcttctgtccgcactgtgatggcccgctgttcaagggcaagcgcgtagcggtgatt
ggtggcggtaactccggcgtcgaagcggccatcgacctggccggcatcgtcagccacgtt
accttgctcgagttcgacagcaagctgcgggctgatgctgtgttacaacgcaagctgttc
agcctgccgaatgtcgacgtgatcaccagcgcactgaccagtgaagttaaaggcgatggc
cagaaagtcaccggcctggtgtacaagaatcgcgacaatggtgagttcacgaccatcggc
ctggaaggcatctttgtgcagatcggtttgttgcccaacaccgattggctcaaaggcacc
gtcgaactgtcgccccggggcgagatcattgtcgatgcgcgtggcgaaacgtcactgccg
ggtgtattcgctgccggtgacgtgaccaccgtgccgtacaagcagatcgtgattgcggtg
ggcgagggcgccaaggcttccctgagcgcgttcgatcacctgatccggacctcggcgccg
gcctga

DBGET integrated database retrieval system