KEGG   Pseudomonas veronii: PverR02_29830Help
Entry
PverR02_29830     CDS       T04853                                 

Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
pvr  Pseudomonas veronii
Pathway
pvr00030  Pentose phosphate pathway
pvr01100  Metabolic pathways
pvr01110  Biosynthesis of secondary metabolites
pvr01120  Microbial metabolism in diverse environments
pvr01130  Biosynthesis of antibiotics
pvr01200  Carbon metabolism
pvr01230  Biosynthesis of amino acids
Module
pvr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pvr_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PverR02_29830
Enzymes [BR:pvr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     PverR02_29830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AQY69074
LinkDB All DBs
Position
6509912..6510583
Genome map
AA seq 223 aa AA seqDB search
MTQDQLKQAVAQAAVDLILPKLDDKSIVGVGTGSTANCFIDALAKHKGAFDGAVASSEAT
AARLKGHGIPVYELNTVSDLEFYVDGADESDAHLNLIKGGGAALTREKIVAAVAKTFICI
ADASKLVPVLGAFPLPVEVIPMARSHVARELVKLGGDPVYREGVLTDNGNIILDVYNMQI
TNPVELETQINAIVGVVTNGLFAARPADVLLLGTPEGVKTLKA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggatcaactcaaacaggcagtggcccaggccgccgtcgatttaatccttcct
aaactcgatgacaagagcatcgtcggcgtcggcaccggctccaccgccaactgcttcatc
gatgcgctggccaagcacaagggcgcgttcgatggcgccgtggccagctccgaagccacc
gccgcgcgcctcaagggccatggcattccggtgtacgagctcaataccgtcagcgacctg
gagttctacgtcgacggcgccgatgaaagcgacgcgcacctgaacctgatcaagggcggt
ggcgcggccctgacccgcgagaagatcgtcgcggccgtggccaagacctttatctgcatc
gccgacgccagcaaactggtgccggtactcggcgccttcccgctgccggtggaagtgatc
ccgatggcccgcagccacgtggcccgcgagctggtgaagctgggcggcgacccggtgtac
cgcgaaggcgtgttgaccgacaacggcaacatcatcctcgacgtgtacaacatgcagatc
accaacccggtggagcttgagacgcagatcaacgccatcgtcggcgtggtcaccaacggc
ctgttcgccgcacgcccggctgacgtgctgctgctgggcaccccggaaggcgtgaaaacc
ctcaaggcctga

DBGET integrated database retrieval system