KEGG   Candidatus Planktophila versatilis: A1sIA79_00585Help
Entry
A1sIA79_00585     CDS       T05250                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pvs  Candidatus Planktophila versatilis
Pathway
pvs00620  Pyruvate metabolism
pvs00680  Methane metabolism
pvs01100  Metabolic pathways
pvs01120  Microbial metabolism in diverse environments
pvs01200  Carbon metabolism
Module
pvs_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pvs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A1sIA79_00585
  09102 Energy metabolism
   00680 Methane metabolism
    A1sIA79_00585
Enzymes [BR:pvs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A1sIA79_00585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ASY16768
LinkDB All DBs
Position
complement(117330..120056)
Genome map
AA seq 908 aa AA seqDB search
MTTKSTDTAKSLVASDDATLRADVRHLGDLLGQSLVRQEGPELLELVESVRKSVREGGGV
EILEKLSVEDSVQLVRAFSTYFNLANVAEQVHRSRVLAEVRAEGGSWITRAIDKIEDAIA
NPVAGHEISHEDLVKWISELDVRPVFTAHPTEAARRSVLSKLGEIASLLDTPASVTQDER
LAETVDLLWQTDELRLDRPEPLDEAMNALYYLDDLATSTVPEVLNDFARELKRIGIELPV
TSRPLTFGTWIGGDRDGNPNITPAITEDAVVLQVGHAIRTTIAAMNKLRQMLSVSTRIAG
ATPELSASVEKDLKNIPEFEERFLRLNVQEPYRLKATAIVHRLAFTRQRHAVRGPHVPGR
DYKNTAELLADLTLMRDSLFAHRGELLATGLLERTIRTVAAFGLTHATLDIREHSDAHHK
VLQQMLGPDYAGLSHEEKFPILIAQLASSARLDASKLDAAGAKTLNTFVAIEDLIERFGP
EVIETYIVSMTKGADDLIAATVLGKQAGLVDIDKKIAKIGFAPLLETVAELRAAGEILEK
LLANPTYRTLVALRGDVQEVMLGYSDSNKDAGIATSQWEIHRAQRMLRDVAVKHGVKLRL
FHGRGGSVGRGGGPTYDALIALPWGSVDGQIKMTEQGEVISDKYSLPALARENVELTLAA
SLEATILNRGPRQSAEDLQKWNDCMNLVSDNSFTRYRALVDHPDLPAYFYASTPVEQLGN
LFLGSRPSRRPDAAGGLDSLRAIPWVFGWTQSRQIVPGWFGVGSGLKAAREAGKSDVLAQ
MLSEWHFFSTFISNVEMTLAKTDLVTAKHYVQTLVPSELHHFLDVITAEFELTVAEILTL
TGKTSLLGDQPVLARTLQVRDTYLAPLQLLQVTLLNRVREQGEKADPALIRALLLTINGV
AAGLRNTG
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaaatcaacggacacagccaagagcttggttgcatcagatgatgccactctt
cgcgcagatgtccgtcatttgggagatctcttaggtcagtccttagttcgccaagaaggc
ccagagcttcttgaactagtcgagagtgtgcgaaagagtgttcgcgaaggtggcggcgtt
gaaattctggaaaaactctccgtcgaagattcggtgcagttagtacgtgcatttagcact
tacttcaacttggcaaatgtggcagagcaagttcaccgctcgcgagttctagccgaagtt
cgcgccgaaggcggttcttggattacacgcgcaatcgacaagattgaagatgcaattgca
aatcctgttgcaggtcacgaaatttctcacgaagatctcgttaagtggattagtgaatta
gatgtgcgaccagtttttaccgcgcaccccactgaagctgctcgtcgttctgtcttaagt
aaattgggtgaaatcgcttcacttcttgatacccccgcaagtgttacgcaagatgagcgt
ttagctgaaactgttgatctactttggcagacagatgagttgcgactagatcgcccagag
ccactcgatgaagcgatgaacgccttgtattacctcgatgaccttgccacctccacagtt
cctgaagttctcaacgacttcgcccgcgaattaaagcgaattggaattgaattacctgtg
acatccagacctttaacatttggaacctggattggcggtgaccgtgatggaaacccaaat
atcacacctgcaattaccgaagacgctgtggtgcttcaggtcggccatgcaattagaacc
acgattgcggcaatgaacaagctgcgccagatgctctcagtttctacccgcattgcaggt
gctacacctgaactaagcgcatctgttgaaaaagatttaaagaatattccagaatttgaa
gagcgatttttgcgcctgaacgtgcaagagccataccgactaaaggcaactgcaatcgtg
catcgcctggcatttactcgccagcgtcatgccgtgcgaggtccacatgtaccaggtcgc
gattacaagaacactgcggaacttctggcagatctcacactcatgcgcgattcactcttt
gcccatcgcggtgaacttcttgcaactggcctacttgaacgcaccattcgcacagttgct
gcctttggtctgacccatgcaacccttgatattcgcgagcactctgatgctcaccacaag
gtgctgcagcaaatgcttggccctgactatgccggactttcacatgaagaaaagttccca
attctcattgctcagcttgcatcatctgcgcgacttgatgcctcaaagctagatgcagct
ggagctaaaacactgaatacctttgtggcaatcgaagatttaattgaacgcttcggtcca
gaagtcattgaaacctacatcgtctcgatgacaaagggtgctgatgatctcatcgcagca
actgttctcggtaagcaagctgggcttgttgatattgataagaagattgccaagattgga
ttcgcaccacttcttgaaacagtggcagagctgcgcgcagcaggtgaaattctcgagaag
ttattagctaaccctacctatcgcaccctggtcgcacttcgcggtgatgtgcaggaagta
atgctcggatactcagattcaaataaagatgccggaatcgcaacatcgcagtgggagatt
caccgcgcacagcgcatgctgcgcgacgttgcagtcaagcacggcgtgaagcttcgtcta
ttccatggtcgtggtggttcggtcggtcgcggtggagggccgacatatgacgcactaatt
gcccttccttggggttcagttgatggccaaatcaagatgaccgaacaaggtgaagttatt
tcagataagtactcactgccagctctcgcgcgcgagaatgtcgaactcactttggccgca
tcacttgaggcaacaattcttaatcgcgggccgcgacagagcgctgaagatttgcaaaaa
tggaatgactgcatgaacttagtaagtgacaactccttcactcgctaccgtgcactcgtt
gatcacccagatcttcccgcctacttctatgcctcaactccggttgaacaacttggaaat
ctcttccttggatctcgtccgtcgcgtcgacctgatgcagccggtggtcttgattcactg
cgtgctattccatgggtatttggttggacccaatctcgtcagattgttcctggctggttt
ggtgtgggctcggggttaaaggctgctcgtgaagccggaaagtcagatgtgctggcgcag
atgctttcagaatggcacttcttctcaacatttatcagcaacgtggagatgactctggca
aagactgatcttgttactgcaaaacattatgttcagacccttgttccatctgagctacat
cacttcctagatgtaatcactgcagagtttgaactcaccgttgccgagattctcactctg
accggcaagacatcattgctgggagaccaaccggtcttggctcgcacattgcaggtacgc
gatacctatcttgctccacttcaacttctgcaggtcacacttcttaaccgtgtgcgcgaa
caaggcgagaaggccgacccagctttgatccgtgccctgctactcacaatcaacggtgtt
gcagcgggacttcgcaataccggctga

DBGET integrated database retrieval system