KEGG   Candidatus Planktophila versatilis: A1sIA79_00910Help
Entry
A1sIA79_00910     CDS       T05250                                 

Definition
(GenBank) nickel superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
pvs  Candidatus Planktophila versatilis
Brite
KEGG Orthology (KO) [BR:pvs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A1sIA79_00910
Enzymes [BR:pvs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A1sIA79_00910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: ASY16827
UniProt: A0A249KMX3
LinkDB All DBs
Position
complement(184966..185364)
Genome map
AA seq 132 aa AA seqDB search
MRNFLTPKVTVHAHCDLPCGVYDPAQAKIEALSVKACMEKYAANTDADFRSRSVAIKEER
SHQVKEHLWVLWTDYFKAPHFEAYPQLHSLFNDATKLAGAAGTKGTQDVKVADQLIAKID
EIAEIFWATKKA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactttcttacacctaaagtcactgttcacgcacactgcgatcttccatgtggc
gtttacgatccagcacaagcaaagattgaggctctctcagtaaaagcttgcatggagaag
tacgcagcaaatacagatgcagatttccgttcacgttctgttgcaattaaagaagagcgt
tcacaccaagttaaagagcacctctgggttctctggactgattacttcaaggctccacat
ttcgaggcctacccacagttgcactcactctttaatgatgcaacaaagcttgcaggtgct
gcaggaactaagggaactcaggatgtaaaggttgcagatcaactcattgcaaaaattgat
gagattgctgaaatcttctgggcaactaagaaggcctaa

DBGET integrated database retrieval system