KEGG   Pogona vitticeps (central bearded dragon): 110069799
Entry
110069799         CDS       T05000                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04010  MAPK signaling pathway
pvt04137  Mitophagy - animal
pvt04210  Apoptosis
pvt04218  Cellular senescence
pvt04620  Toll-like receptor signaling pathway
pvt04621  NOD-like receptor signaling pathway
pvt04622  RIG-I-like receptor signaling pathway
pvt04623  Cytosolic DNA-sensing pathway
pvt04625  C-type lectin receptor signaling pathway
pvt04920  Adipocytokine signaling pathway
pvt05132  Salmonella infection
pvt05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110069799 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110069799 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    110069799 (RELA)
   04218 Cellular senescence
    110069799 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110069799 (RELA)
   04621 NOD-like receptor signaling pathway
    110069799 (RELA)
   04622 RIG-I-like receptor signaling pathway
    110069799 (RELA)
   04623 Cytosolic DNA-sensing pathway
    110069799 (RELA)
   04625 C-type lectin receptor signaling pathway
    110069799 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110069799 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110069799 (RELA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110069799 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pvt03000]
    110069799 (RELA)
Transcription factors [BR:pvt03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    110069799 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 110069799
NCBI-ProteinID: XP_020633015
UniProt: A0A6J0SD73
LinkDB
Position
Unknown
AA seq 582 aa
MCAFFIGSTDDALAVSDPNASEPDLHAADLLPLIFQQTWDPAPSSTPFAEIIEQPKQRGM
RFRYQCEGRLAGSIPGERSTDTTKTHPTIKIHNYVGPGKVRISLVTKESPYRPHPHDLVG
KDCREGYYEAELSPERSIHSFQNLGIQCVRKRDLDKAVARRLETANNPFNVSAEELKGDY
DLNAVRLCFQVWIRDAGSSRLVQLPLVVSQPIYDNRAPNTAELKICRVNRNSGSCLGGDE
IFLLCDKVQKEDIEVRFFKDSWEARGSFSQADVHRQVAIVFKTPPYMDQTLREPVTVQMQ
LRRPSDKEVSGPMEFRYLPDEGDFHRIEEKRKRTLSTFKNFVQKAPFAVGAPESRSPRRI
AVPKHSLARPSSSGIPGLLGASAPSAAPKPQMMLQPPAGFFARPSHTPPAPAPAAATQSA
FTTVNMEDLSGLGVSQPPPPPESEAETSIADAFLNLHFEGGDAGSMELGGLLDDAPYTSL
EGINTAEFRQLLTGGGGGGGGGPATGLPDNQGTLLTYPESITRLVSQRRAEGEPGGNGEG
GGGNNAAASSFLNGLLGALPSEDSFSSMVDMDLNSLLSQLNS
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgtgtgccttcttcatagggtctacggatgatgcccttgctgtttctgatcccaacgcc
tccgagcctgacttacacgctgcagatctcctaccactgatctttcaacaaacctgggac
ccggcccccagcagcaccccgtttgcggagatcatcgagcagccgaagcagcgcggcatg
cgtttccgctaccagtgcgaagggcgcttggctggctccattcctggggagcgaagcacg
gataccaccaagacccaccccaccatcaagatccataactacgtgggtccaggcaaagtt
cgtatctcgttggtgaccaaggagtccccgtaccggccgcacccccacgacctcgtgggg
aaagactgcagggagggctactacgaggccgagctctctccagaacgctccatccacagc
ttccagaacctggggatccaatgtgtgcggaaacgagacttggacaaagcggtcgccagg
cgccttgaaacggccaacaatcctttcaacgtgtctgcagaagagttaaaaggagattac
gacctgaatgcggttcgactgtgtttccaggtgtggatccgggacgcaggcagcagccgc
ttggtccagctgcctctggtggtctcgcagcccatctatgacaatcgtgcccccaacaca
gctgaactgaagatctgtcgagtgaatcgtaattcgggaagctgcctggggggagacgag
attttcctcctctgtgacaaagtccagaaagaggacattgaagtccggttcttcaaggac
tcctgggaagcaagggggtctttctctcaggccgacgtccaccggcaagtggccatcgtc
ttcaagaccccgccgtacatggaccaaaccctgcgggagccggtgacggtccagatgcag
ctgcgccgcccgtcggacaaggaagtcagcgggcccatggaattccgctatctcccggat
gaaggtgactttcatcgtatcgaggagaaacgcaagcggacactcagtactttcaagaac
tttgtgcaaaaggcgccctttgcagtcggagccccagaatcacgctctccgcgccgcatt
gctgttccgaagcatagcctggcgcggcccagttccagcggcatcccagggcttctggga
gcatcggcgccatcggctgctcccaaacctcagatgatgctccagcctccggccggcttc
tttgcccggcccagccacaccccgcctgctcctgctcctgccgcagcgacacagtccgcc
ttcaccaccgtcaacatggaagacctctccggcctgggggtgtcccagccgccgccgccc
cccgaatccgaggcggaaaccagcattgccgacgcttttctcaacctccatttcgagggt
ggggacgctgggtccatggaactcggagggctgctggacgacgccccttacaccagcctg
gaggggattaacacggctgagttccgccagctcctgacgggaggaggaggaggaggtggt
ggtggtcccgccactgggcttcctgacaaccagggcactctgctgacctaccccgaatcc
atcacccgcctggtcagccagcggagggctgaaggggagccgggtggcaacggagagggc
ggtggagggaacaacgccgcggccagcagcttcctcaatggccttttgggggccctgcct
agcgaggacagcttctcctctatggtagacatggatttgaactcgcttctgagtcagctg
aactcatag

DBGET integrated database retrieval system