KEGG   Pogona vitticeps (central bearded dragon): 110069931
Entry
110069931         CDS       T05000                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04010  MAPK signaling pathway
pvt04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110069931 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110069931 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pvt04052]
    110069931 (KITLG)
Cytokines and growth factors [BR:pvt04052]
 Growth factors
  Growth factors (RTK binding)
   110069931 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 110069931
NCBI-ProteinID: XP_020633162
UniProt: A0A6J0SAA7
LinkDB
Position
Unknown
AA seq 283 aa
MKKAHTWIITCFYLLLLLLNPLVKAQSPCGNPVTDDVNDIPKLVGNLPNDYMIVLKYVRK
MDTLPNHCWLHLMVPELSKSLNNLLNKFTELPEMPDVLSNYSIINNLRRIINDLMQCLSS
TKYKNFRLHHDHLYEEGTFIPEEFFRHFYSTIDVYKIFAKAPVHSDCVLPSTTEIPPNDS
SISVTKPLLLHPFAASHLRNDSSYDNDKKTELGFLSTPSMQGISIALTSLVTLCIGFILG
ALCWKKTAHKHTLESGPSERSNICQEDNEISMLQQKDKSLLQV
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaagaaggcacacacctggattatcacttgcttttatcttctactgctccttcttaat
cctcttgtcaaagcccaaagtccctgcgggaatcctgtgacggatgatgtgaatgacatt
ccaaaactggttggaaatcttccaaatgattatatgatagtccttaaatatgtccggaag
atggacactctgcctaatcattgttggttgcatttgatggtccctgaattgtcaaagagt
ctgaataatcttctcaacaaatttacagaattgccagaaatgccagatgtcttgagtaac
tattcaatcatcaataatctcagaaggatcattaatgatctaatgcaatgcctgtcatct
actaaatataagaattttagactacatcatgaccatctttatgaagagggtacatttatt
ccagaagagttctttaggcacttttatagcactattgatgtgtacaaaatctttgcaaaa
gcaccagtacacagtgattgtgtcctgccgtcaacaacagaaattccccccaatgattcc
agcatcagtgttacaaagcctttattgttacatccttttgctgccagccaccttaggaat
gacagcagttatgataatgacaaaaaaacagaattgggcttcctcagcacccccagcatg
caaggaataagcatagcattaacatcactggtgactctttgtattggctttattttggga
gccttatgctggaagaaaacagcccacaagcatacactagaaagtggcccaagtgaacga
tctaacatctgccaagaggataatgaaataagtatgctgcagcaaaaagacaaatcgctt
ctacaagtgtag

DBGET integrated database retrieval system