KEGG   Pogona vitticeps (central bearded dragon): 110070069
Entry
110070069         CDS       T05000                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04141  Protein processing in endoplasmic reticulum
pvt04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110070069 (ATF6B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110070069 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pvt03000]
    110070069 (ATF6B)
Transcription factors [BR:pvt03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110070069 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB YabA GAS
Other DBs
NCBI-GeneID: 110070069
NCBI-ProteinID: XP_020633344
UniProt: A0A6J0SHV6
LinkDB
Position
Unknown
AA seq 691 aa
MAALASESLLLSDSSRFRADNLLSSEDWDAGLYSCLDNDDDVAAELFPCLEQSMVDSDNS
HSMFSAGFDMAMEIPPPEPPWDPLQDIFFPELQVKSEPVSPASSHCSDSSGASSDSSALS
SSSSSADLPGQAPNPSDVIGVKAEHPPTPPCMFGDVLSPPFGTVHIRVVPAPETGKPVTS
NKAESILSRKPPIQPKPVVVTTVPAQPTTTSSKTILLQSVPVTQSQTINPGISVPGQSVV
ISQSELLHLPVSGLIKVQSPVKEGLPAKPIPAAPKPEAKTIVPAPTQIGPCNQEIDIKVL
KRQQRMIKNRESACQSRRKKKEYLQGLESRLREALTENERLRRENALLRRRLDCVVNENS
ELKFGSGNRKVICVMVVLLFIAFNFGPVSISEHKATEVDFPKQEAEPGPGQRHLLGIIGE
PHEMSEEELEERQEEAPDRPGKTSFRNLSASFSDMKDLMLRDLDKLFLASDCRQFNRTES
LRLADELSGWVRRHQINRRKPSPSRKAPQATQVKREGRPQSSSRYVPASPPRHTERNSVH
QLQVYQHPDHTEHDFMDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAL
NESLYNSSLGYEVMMQIDCEVMDTRVIHIKSSTVPPFLRRQDAVPDNRTQPAPQPFSGRT
ARAALRSHRPTFSSTRRHPHRTLYLGEHGGG
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggcggccttggcttcggaatcgctgctcttgagtgactccagtcgcttccgcgcggat
aacctgctgagcagcgaggactgggatgcaggtctttatagctgcctggataatgacgac
gatgtggcagctgagcttttcccctgccttgaacaaagcatggtggacagcgacaattcc
cattccatgttcagtgctggttttgacatggctatggaaataccacccccggaaccacct
tgggacccactgcaagacatctttttcccagagctgcaggtgaagtctgagccagtctcc
cctgcgtcatctcactgctctgattcgtctggtgcatcctcggattcctctgctttgtcc
tcttcctcctcctctgctgatctccctgggcaggcccccaacccatctgacgtgattgga
gtgaaggcggagcaccctccaacccctccatgcatgtttggagatgtcctttcacccccc
ttcggtactgtgcacatcagggtagtcccagctcctgaaacagggaaaccagtcacttcc
aacaaagcagagagcattcttagtcggaagccccccattcagcccaagccagttgtggta
actactgtcccagcgcagccaacaaccacttccagtaagaccatcttactgcaatctgtt
cccgtaacccagtcacagacgatcaacccaggaatttcagttccaggacagagtgtggtg
atctcccagtctgaactgctgcatctcccagtgtcggggctgatcaaggttcagtctcct
gtgaaagaaggtctccctgcaaagccaattcccgctgcccccaagccggaagccaagact
attgtcccagctccaacgcaaatcggaccctgcaaccaggagatagatatcaaggtcctg
aaaaggcagcagcggatgattaagaaccgggaatcagcctgccagtctcggcggaaaaaa
aaggaatacctgcaagggttggaatcgcggctgagggaggccctgacagagaacgagcga
ctgcgacgggagaacgctctcctccgccggcgactggactgtgttgtgaacgagaacagc
gagctgaagttcggctctgggaaccggaaggtcatctgtgtcatggtggtcctgctcttc
atcgccttcaattttgggcctgtcagcatcagtgaacacaaggcaacagaagtggacttt
cctaagcaggaagcagagcctgggccggggcagaggcacctcctggggattataggggaa
ccccatgaaatgtctgaagaggagctagaggagcggcaagaggaggcaccagacaggcca
gggaagacatcgttccggaacctttcagcttccttttctgacatgaaggatctcatgctg
agggacctggataaattgttcctggcttccgactgccgccaattcaatcgcactgaatcc
ttgagattggccgatgagctcagtggctgggtccgccggcaccagatcaatcggaggaag
ccctcgccgtcccgcaaagcaccgcaggctacccaggtgaagcgagaaggaaggccgcaa
agctcctcgcgctacgtccctgccagcccccctagacacacagagaggaattctgtgcat
cagctgcaggtgtatcagcaccctgaccacacagaacatgacttcatggatgccattgat
cgacgggaggatacgttctatgtggtgtctttccgcagggatcacttactgctgcctgcc
atcagccacaacaaaacgtctcgccccaaaatgtccctggtgatgccagccatggccctc
aatgagagcctgtacaattcctccctgggctacgaggtgatgatgcaaatagactgtgag
gtgatggacacccgggtcatccacatcaagagctccacggtgccccctttcctgaggcgc
caagacgctgtccctgacaaccggacccagcccgctcctcagcccttctctggaagaacg
gcccgggcagctttgcggtctcatcggcccactttctcctccacgaggcggcacccgcat
cgcaccttgtaccttggggagcatggggggggctag

DBGET integrated database retrieval system