KEGG   Pogona vitticeps (central bearded dragon): 110071644
Entry
110071644         CDS       T05000                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2 isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04080  Neuroactive ligand-receptor interaction
pvt04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110071644 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110071644 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pvt04030]
    110071644 (LPAR2)
G protein-coupled receptors [BR:pvt04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    110071644 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 110071644
NCBI-ProteinID: XP_020634962
UniProt: A0A6J0SF73
LinkDB
Position
Unknown
AA seq 354 aa
MWKGIDHSENMTKCYYNESVEFFYNNSGKELFHEWRSKDILVVALGLTVSIIVLLTNLLV
ITAIVINKRFHYPIYYLLGNLAAADLFAGIAYMFLMFHTGPRTAGLSLKTWFIRQSLLDT
SLTASVVNLLAIAVERHQTVFTMQLHSKMSNQRVMILICCIWITALLLGLIPSYGWHCLC
QLDDCSRMAPLYSRRYLTFWALSNLFIFIIMVIVYAHIFIYVKRKMARMSKHTTFHPRYK
DTMINLIKTVIIILSAFVICWTPGQVVLLLDGLGCKSCNVLAVEKYFLLLAEINSLINAI
VYSYRDNEMRSTFRKILCFACYRMPKYSPASVKASTTEQRILPQNGHPIMDSTL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtggaaggggatcgaccattctgaaaacatgaccaagtgctattacaatgagtcagtc
gagttcttctacaacaacagtgggaaggagctattccatgaatggaggtcgaaggatatc
ttggtggtagctcttggtttgactgtcagcatcattgtgctcctcaccaacttgcttgtc
atcacagccattgtgatcaacaagcgcttccactatcccatctattacctcttggggaac
ttggccgctgccgacctctttgctggcattgcttacatgttcttgatgttccacacaggg
cctaggaccgctggcctctctctcaagacctggttcatcaggcagagcctcttggatacc
agtttgacggcctccgtggtcaatctcttggccattgccgtggagcggcaccagacagtt
ttcaccatgcagctccacagcaagatgtccaatcagcgtgtgatgatcctcatctgctgc
atttggattacagctctgttgctgggcctcatcccctcatacggctggcactgcttatgc
cagctggatgactgctcccggatggcgcccctctacagccgcagatacttgactttctgg
gctctctccaatctcttcatcttcattatcatggtgatcgtctatgctcacattttcatc
tatgtgaagaggaagatggcacggatgtcgaagcacaccactttccatccacgctataag
gacactatgatcaaccttatcaagacagtcatcatcatcctcagtgcttttgttatctgc
tggactcctgggcaggtggttctcctgttggatggccttggttgtaaaagctgcaatgtg
ctagcagttgagaagtactttctgctgctggctgaaatcaattcactcatcaatgccatt
gtctactcctaccgggacaatgaaatgcgcagcaccttccggaagatcctttgctttgcc
tgctacaggatgcccaagtactctccagcttcagtcaaggccagtaccacagagcagagg
atactgcctcagaacgggcatcctatcatggactccactctctaa

DBGET integrated database retrieval system