KEGG   Pogona vitticeps (central bearded dragon): 110071755Help
Entry
110071755         CDS       T05000                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00010  Glycolysis / Gluconeogenesis
pvt00030  Pentose phosphate pathway
pvt00051  Fructose and mannose metabolism
pvt00052  Galactose metabolism
pvt01100  Metabolic pathways
pvt01200  Carbon metabolism
pvt01230  Biosynthesis of amino acids
pvt03018  RNA degradation
Module
pvt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110071755
   00030 Pentose phosphate pathway
    110071755
   00051 Fructose and mannose metabolism
    110071755
   00052 Galactose metabolism
    110071755
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    110071755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pvt01009]
    110071755
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pvt03019]
    110071755
Enzymes [BR:pvt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     110071755
Protein phosphatases and associated proteins [BR:pvt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110071755
Messenger RNA biogenesis [BR:pvt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     110071755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 110071755
NCBI-ProteinID: XP_020635060
LinkDB All DBs
Position
Unknown
AA seq 745 aa AA seqDB search
MAQKMSSQTPARHEHADTMGVGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVYFVHE
GYQGLVDGGDNIKEATWESVSMMLQLGGTVIGSARCMDFRVREGRLKAARNLVKRGITNL
CVIGGDGSLTGADTFRAEWSGLLQDLVKTGGITAEEAKRSSHLNIVGMVGSIDNDFCGTD
MTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALITALASGADWVFIPES
PPEDNWEDHLCRRLTETRTRGSRLNIIIVAEGAIDKHGKPITSEDIKTLVVKRLGYDTRV
TILGHVQRGGTPSAFDRILTKDVTTAMNEGRFDEALKLRGRSFQNNWNVYKILAHVRPPT
AKSGYNLAVMNVGAPAAGMNAAVRSTVRIGLIHGHRMLAVHDGFEGLAEGKVEEIGWSGV
GGWTGKGGSCLGTKRTLPKKYFEEISQTIASFNIHGLIIIGGFEAFTGSLEMVEGRAKFE
ELCIPICVIPATVSNNVPGSDFSIGADTALNTITTTCDRIKQSAAGTKRRVFIIETMGGY
CGYLATMAGLSAGADAAYIYEDPFTIHDLEMNVHHLTEKMKTTVKRGLILRNEKCNENYT
TDFIYNLYSEEGKGIFDTRKNVLGHMQQGGTPTPFDRNFGTKMGAKSVAWITGKIKECTR
HGRIFANTADSACLLGMRRRALVFQPLAELKEETDFEHRIPKSQWWLKLRPILKVLAKYK
IDLDTSEKAHLEHITRKRVSGEGAL
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaaaatgtcgtcccaaacaccggcgagacatgagcacgcggacacgatgggg
gtcggcaaggccattgccgtcttgacgtccggaggagatgcccagggcatgaacgctgct
gtccgggcagtggtccgagtggggatatacactggtgccaaagtctactttgttcatgag
ggttaccaaggacttgtggatggtggcgacaacattaaggaagcaacatgggaaagtgtg
tctatgatgctgcagctgggtggcacggtgattgggagtgcccggtgcatggatttccgt
gtgcgggaaggacgcctgaaagctgctcgcaacctggtcaagagaggaatcaccaacttg
tgtgtgattgggggtgatggcagcttaactggagcagacactttccgagcagaatggagc
ggtttgctacaggacctagttaagacaggtggcatcacagcagaagaggcaaagaggtct
agccacctgaacattgtaggcatggttggctccattgacaatgacttctgcggtaccgac
atgaccattggcacagactcagctctccaccgaatcatggagattgtggacgccatcact
accactgcccaaagccaccagaggacatttgtgctggaggtgatgggtcgtcactgcggt
tatcttgctcttataacagccttggccagtggtgcagactgggttttcattcctgaatct
ccaccagaagataactgggaagatcacttgtgcaggaggctgacagagactagaactcga
ggctcccggttgaacatcattattgtggctgaaggagcaatagataagcacggcaagccc
atcacctcggaggacatcaaaactctggttgtgaaacgcctgggctatgacacaagagtc
accatcttgggccatgtgcaacgtggtgggaccccctctgcctttgaccgtattctgaca
aaagatgttacgacagccatgaatgaaggacggtttgacgaagctcttaaactgagggga
aggagtttccagaacaactggaatgtctacaagatcctggcccacgtgcgcccacccact
gcaaagagtggctacaatttggcagtgatgaacgtgggcgcaccggcagctggcatgaat
gcagcagtgaggtcaaccgtcagaattggtttgatccatggccacaggatgctggctgtt
catgatgggttcgaaggccttgctgaaggaaaggttgaagaaattggatggtcaggagtt
ggtggctggactggaaaaggtggatcatgtcttggaaccaaaaggactctgcccaagaaa
tactttgaggagatcagccaaaccattgccagtttcaacattcatggcctgataattatt
ggtggctttgaggctttcactggcagcctggagatggtcgagggccgagccaaattcgaa
gagctctgtatcccaatctgcgtgatccctgccactgtctccaataacgtccctggctct
gacttcagcatcggggcagacacagccctcaacactatcacgacgacctgtgaccgtatc
aagcagtctgccgctggcaccaagagacgggttttcatcattgagaccatgggaggctac
tgtggctacttggctaccatggcaggcttgtctgccggagcagatgcagcctacatttac
gaagaccctttcaccatccatgatttagagatgaatgtccaccatctgactgagaagatg
aagaccacagtgaagagaggtcttatactgagaaatgaaaaatgcaatgagaactatacc
actgattttatatacaatctgtattccgaggaaggaaaaggcatctttgacaccagaaag
aatgttttgggacacatgcagcagggtgggacgccaactccgtttgacagaaactttggg
acaaaaatgggcgcgaaatcagtggcgtggataactggcaagatcaaagaatgcaccaga
catggtcgtatctttgccaacactgctgattcagcttgcctcctgggcatgcgcagaagg
gccctcgtattccagcctcttgctgaacttaaggaagagacagattttgagcatcgcatc
cccaagtcgcagtggtggctgaagcttcgtcccatcttgaaggtcctggccaagtacaag
atcgacttggatacctcggagaaagcccacttagagcacattactcgtaagagagtatcg
ggagaaggtgccctgtga

DBGET integrated database retrieval system