KEGG   Pogona vitticeps (central bearded dragon): 110071879Help
Entry
110071879         CDS       T05000                                 

Gene name
LCT
Definition
(RefSeq) lactase-phlorizin hydrolase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00052  Galactose metabolism
pvt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    110071879 (LCT)
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     110071879 (LCT)
    3.2.1.108  lactase
     110071879 (LCT)
Chaperones and folding catalysts [BR:pvt03110]
 Intramolecular chaperones
  Others
   110071879 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Glyco_hydro_10
Motif
Other DBs
NCBI-GeneID: 110071879
NCBI-ProteinID: XP_020635330
LinkDB All DBs
Position
Unknown
AA seq 1895 aa AA seqDB search
MELVFRLSLVFLLLLPCTGVDWDLSQHFIFIAGPLTNDLVNNLNGQSGHGREPAFPFERA
QPDFLCHQPSISSLEPYFDELRASGVTHFKVFLPWTRLLPEGNAQNPNKANVECYRQLLR
TLRAAQLKPVLVLNQWVLPKSLGPQLSLTESTTFVDLFVEYAKFSFESFGDLVDTWLTFS
NLPEVAEGLSHGDPLDNPLQVFATAHEKAYKMYHENYSSEDGRVSISLDIHDAVLVPPGS
FLASILDFLDFLSLSLQYNCKRKASIEKMLDELQVILSNYTIYENEAWVIGYDVNSFLDN
SPIQAACSYAENLAIQSKPEEALISAITPLSSYQMVWEKISNQSVEERDLFLHDTFPSNF
LWGTSTGAFNVEGGWAEAGKGESIWDRYGHQGHTYVNQTADVACDSYHKIEYDLYALRGL
QSKIYKFSISWPRIFASGNKDSLNSQGVDYYNKLIDGLLDSNIEPMVTLFHWDLPQALQD
LGGWQNESIISAFVDYASFCFATFGDRVKFWITFHEPWVISYAGYGTGQHPPGIVDPGVA
SYEVAHVILKAHAQAWHIYDAQYRPKQNGKVGIVLNSDWAEPNTPGRPEDISAAERYLHF
MLGWFAHPIFVNGDYPEVLKSQIEQINQQCSSPVAKLPAFLDDEKKLVNGTADFFGLSHY
TSRLISASANPACTPSYQNIGGFTPHVNLSWPQTAAPWIYSVPWGLRRLLLFVSREYTGA
RIPIYIAANGAPTDDGSDLVNDTLRIDYYRLYINEALKAVKLDAVDVQAYIARSLLDGFE
GPAGYSQRFGLHYVNFKDADRPRTPKESAYFFSSVIENNGFPRVVTRKSPQTLKEDISMP
PRLPSLPASEVPSEAKVVWERFSGQTNFEQDMFFYGTFPEDFRWGVSTSAYQIEGSWDAD
GKGPSIWDNFTHVPGNIQNNATGDIACDSYNKMDADLYSLRGLRVNSYRFSLSWPRIFPD
GTNNSINSYGVGYYNRLIDGLLAQNIRPMVTLHHWDLPQALQDIGGWQNPDLAEIFASFA
DFCFQTFGDRVKFWMTFNEPLLISWRGYDSGVFPPNVKDNPGYSAYQVTHTILKAHARAY
HIYDQKYRATQKGVVSLSMSIDWVEPEMPNDPRNVEAADQHLQFEVGWFAHPIFKNGDYP
DAMKWKVGNRSELQNLPSSRLPVFTEEEKEYIKGTADVFCLNYYVTNIIKHKTTRLTPFS
YEDDREQVLHNDPSWPTTANNNRAVAWGLRRVLNWIKVEYGNPPIYITENGVSTNANVDD
ITRIFFHKTHIDEALKAYTLDGVNLRGYVAWSLMDNFEWLEGYEAKFGLHQVDFEHPNRP
RTPRSSAIYFAEIIRQNGIPLPKDEEFIYGEFPNNFIWSVASAAYQIEGAWRAEGKGLSI
WDQFTHTPLRISNDENGDVACDSYHKMDADLAILKSLQVTHYRFSISWPRVLPDGTTRYI
NEAGLKYYERLVDALLAANIQPQVTLYHWDLPQALQNVGGWENETIVQRFKEYAEVLFQR
LGEKVKFWITLNEPFNTANNGYGYGVAAPGIYTRPGHAPYIVAHNLIKAHAEVWHLYNDT
YRPTQGGLISLSINTDWAEPRNPHKQEDIDAARRYLQFFAGWFAHPIFKNGDYSEVMKKR
IQERSQGQSRLPEFTESEKQRIKGTYDYFGLNHYTTVLTYNLNYPAFITSYDADRGVASI
TDRSWLGSGSSWLKVTPFGFRRLLKWIKEEYNNPPIYVTENGISERVDGGFNDTWRIHYL
KNYINEALKAVILDGVDLRGYTVWCLMDNFEWAVGFSERFGLHYTNYTDPTLPRIPKESS
KYYSSIIRCNGFPDPASGPHLCLEPQVESTSLPPSNTTLPAIKPVQFLDLDLTSSQATTA
LYTLFALLLVAVLGLGLFSFVYTKMIKKSRRERQM
NT seq 5688 nt NT seq  +upstreamnt  +downstreamnt
atggagttggttttcaggctatctctggtttttctgcttctgctgccttgcactggagta
gactgggatctttctcagcattttatttttattgctggtcctcttactaatgatttagta
aacaatttaaacggccaaagtggacatggaagagaacctgcttttccttttgaaagggcc
cagccagatttcctttgccaccagccttctatctcttctttggagccatactttgatgaa
cttcgtgcaagtggtgtgactcactttaaggttttcttgccttggactcgtctacttccc
gaggggaatgcccaaaatcccaacaaggctaatgttgaatgctacagacaacttctcagg
accctccgtgctgctcagcttaagccagttttagtcttaaatcagtgggtcttgcccaag
tctttgggcccccagttatcgctgaccgagtctacaactttcgttgacctttttgtggaa
tacgccaagttttcttttgagtcgtttggtgacttggtggatacctggctcactttcagc
aacctgcctgaagttgcagaaggactgagtcatggggatccactagacaatcctctccag
gtgttcgcaacagcgcatgaaaaggcatataaaatgtaccatgaaaattattcttcagaa
gatggaagagtgtccatttcattagacattcatgatgctgtgttggtgccaccaggatct
ttcttagcttccattttggactttctagatttcttatctctcagtctacagtacaactgc
aaaaggaaagcaagtattgaaaagatgctggatgaattgcaggtaattctgagcaattac
acgatttatgaaaatgaagcatgggtcataggatatgatgtgaattctttcttggacaac
tcacccattcaagcagcatgctcctacgcagaaaatctagccatccagtcaaagccagag
gaggcattgatatcagccatcaccccactttcatcctaccaaatggtttgggaaaaaatt
agtaatcagtctgtggaagagagagacctttttttgcatgatactttcccgagcaatttt
ctttggggcacttcaacaggagcctttaatgttgaaggtggctgggcagaagctggcaaa
ggagaaagtatttgggaccgatatggccatcaaggtcacacctatgtgaatcaaacagcc
gatgtggcgtgcgatagctatcacaaaatagagtacgatctttatgcgctcagaggcctt
cagtcaaaaatctataaattttctatatcatggcctaggatttttgccagtgggaataag
gacagcttgaattctcaaggagtggattactacaataaactcatagatggcttgctggat
tctaacattgaacctatggtgaccttgttccactgggaccttcctcaagccctgcaggac
ttaggcggctggcaaaacgagagcatcataagtgcctttgtagactatgcgtctttctgc
tttgctacttttggggatcgagttaaattctggattaccttccacgaaccctgggtcatc
agctacgctggctatgggactggacagcatcctccaggaattgttgacccaggagtagca
tcatatgaggtggctcatgttattctcaaagctcacgctcaagcctggcatatttatgat
gcccagtatcgccccaaacaaaatgggaaggtgggaattgttctgaattccgattgggct
gaaccaaacacgccaggaagacccgaggatataagtgcagctgaacgttacttgcatttc
atgctgggctggtttgctcacccaatatttgttaacggtgattacccggaggtcctgaaa
tcccagattgagcagattaaccagcaatgttcttccccagttgctaaactccctgctttc
ctggacgatgagaagaaactggtgaatgggacggctgacttcttcggcctttcccattac
acttccaggctcatcagcgcctcagcaaatcctgcctgcactccgagttatcagaacatt
gggggctttaccccacacgtaaatctgtcctggccgcagacagctgcaccttggatctat
tcggtgccctggggactgaggagattgctcctctttgtatccagagaatacactggggca
aggatcccaatttatatagcagcaaatggtgcaccaacagatgatggaagtgatttggtt
aatgatacactgagaatagattactaccgtctctacatcaatgaggctttaaaagctgtg
aagctggatgccgtcgatgtgcaggcatacattgcccggtctttgctggatggctttgaa
ggcccagcgggatacagtcaaaggtttggccttcactacgtgaatttcaaagatgcagac
agacctcggacccccaaagaatctgcatatttcttctcctctgttattgaaaacaatggg
tttcccagagtggttacaaggaaatcacctcagacactcaaagaggatatttccatgcct
ccacgtttgcctagtttaccagcttctgaagttccctcagaagcaaaagtagtttgggaa
agattttctggccagactaattttgaacaggatatgttcttctacggcactttcccagaa
gattttcgctggggagtgtccacttctgcctaccaaattgaaggaagctgggatgcggat
ggaaaaggacctagcatatgggataactttacccatgtccctgggaatattcagaataat
gctacaggagacatagcttgtgacagctacaataaaatggatgctgatctttattcactg
agaggcttaagagtgaacagctatcgcttctcactctcatggcctcgaattttcccagat
ggaacaaacaattccataaatagctatggtgttggttattacaatcgtctgatagatggt
ttgctagcccaaaacatcagaccgatggtcactctccaccactgggatctgccccaggct
ttacaagacattggtggttggcagaatcctgacctggctgagatctttgcaagttttgca
gacttctgttttcagacttttggagacagggtcaagttctggatgactttcaatgagcct
ctgctgatttcatggcgaggttacgattcaggtgttttcccaccaaatgtcaaagataat
ccagggtactcagcctaccaagttactcacacgatactgaaggctcatgccagagcatac
catatatatgaccagaaatacagagccactcagaaaggtgtggtctctttgagcatgagc
atagattgggttgaaccagagatgccaaatgatccccggaatgtggaggcagctgaccag
catttgcaatttgaagtgggatggtttgcgcacccaatttttaaaaatggcgattaccca
gatgccatgaagtggaaagtcggaaacagaagtgagctgcagaacctgccatcctctcgg
cttccggttttcacagaagaagagaaagaatatattaagggcacggctgatgtcttctgc
ctgaactattatgttaccaatattataaaacacaagacaactaggctgactccgttctcc
tatgaagatgaccgagaacaagtgttgcacaatgacccttcttggccgactacagcaaac
aacaatcgagcagtggcctgggggctgcggagggtactcaactggatcaaagtggaatac
ggcaatcctcccatttacatcaccgaaaatggagttagcacaaatgctaatgtggatgat
atcaccagaatctttttccacaaaacccatattgatgaggctttgaaagcttacactctg
gatggggtgaaccttcgaggctatgtggcctggtctttaatggataattttgaatggtta
gaaggttatgaggcaaaatttggtctgcaccaggttgattttgaacatccaaacaggcca
agaactccaagaagttctgctatatattttgctgaaatcatacgtcagaatggaatccca
ctgccaaaagacgaggagttcatttacggggaatttccaaataatttcatttggagtgtg
gcatcagcagcataccagattgaaggggcctggagagctgaagggaaaggactcagcata
tgggaccaatttactcacacacctttgagaatcagtaatgatgaaaatggcgatgttgct
tgtgacagctaccacaagatggatgcagatctggctattctgaaaagcctccaagtgact
cattatcgtttttccatctcctggcctcgtgtgctgccagatggaaccacccgctatata
aatgaagctggtctgaaatactatgaaaggcttgttgatgctctccttgcagccaatata
cagcctcaggtcactctgtaccactgggacctccctcaggctcttcaaaatgttggaggt
tgggaaaatgagactatagtccagcgatttaaagaatatgcagaggttctctttcaaagg
cttggagagaaagtgaaattttggataactttgaatgagccttttaacactgctaataat
ggttatggttacggagtagctgctccaggcatttatacaaggccaggccatgcaccttac
attgtggcacacaatttgatcaaggcccatgctgaagtctggcatctctacaatgatact
taccgtcccacacaaggagggctgatctctctgagcatcaacaccgactgggctgaacca
aggaaccctcacaagcaggaggacattgatgctgccaggagatatctccagttctttgct
ggctggtttgctcatcccatcttcaaaaacggtgactatagtgaggtgatgaaaaagagg
atccaggagagaagccagggacaatcacggcttcctgaatttactgaaagtgaaaagcag
agaattaaaggcacctatgactattttggtctgaaccattataccacagtactaacgtac
aacttaaactatcctgcttttattacctcctacgatgctgatagaggtgttgcctccata
acggaccgcagctggctggggtctggctcttcgtggctgaaggtgaccccatttggcttc
agaaggctcttgaagtggatcaaggaagaatacaacaacccccctatttatgtgacagag
aatgggatttcggaacgggtagatgggggcttcaatgacacttggcgaatacattactta
aagaactacatcaatgaagctttgaaagcggttatacttgatggtgtcgatttacgagga
tacactgtttggtgcctgatggacaattttgaatgggcagttggcttcagtgagaggttt
ggattacattataccaactacacagatccaactttacccagaattccaaaggaatcttca
aaatactattcctctatcatccgttgtaatggctttccagatccagcctctgggcctcat
ttgtgtctagagccacaagtagaaagtacaagtctgccacctagcaacacaactttgcct
gccataaagccagtacaatttttggatttggacctgacgtcttctcaagccacaacagcc
ctttatacattatttgcactgctcctggtcgctgtactaggccttggtcttttttcattt
gtgtacacaaagatgattaaaaaaagcagaagagaacgtcagatgtaa

DBGET integrated database retrieval system