KEGG   Pogona vitticeps (central bearded dragon): 110072211
Entry
110072211         CDS       T05000                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04010  MAPK signaling pathway
pvt04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110072211 (TGFA)
   04012 ErbB signaling pathway
    110072211 (TGFA)
SSDB
Motif
Pfam: Collectrin Insulin_TMD
Other DBs
NCBI-GeneID: 110072211
NCBI-ProteinID: XP_020636027
UniProt: A0A6J0SI79
LinkDB
Position
Unknown
AA seq 180 aa
MGTSCKGERNEGREEALLRLLAEDWKLRKRDYVTGVLLAVCHALENTTSALSGPPVAAAV
RSHFNSCPDAHSHFCFHGTCRFVVQEEKPACVCHSGFVGTRCEHADLLAVVAANQKKQTI
TALVVVSVIASVVLIGVCVLIHCCRVRKHCGWCRTVVCRHEKPSGLLKGGSSCCHSETVV
NT seq 543 nt   +upstreamnt  +downstreamnt
atgggtacgtcatgcaagggagaacgaaatgaaggcagggaggaggccctcctcaggctc
cttgctgaggactggaaacttagaaaaagggattatgttacaggggttttattagcggtg
tgccatgccttggagaatacaacatcggccttaagcggtcccccagtggcagcagctgtg
aggtcccactttaacagttgtccagatgcccacagtcacttctgtttccacgggacatgc
cggttcgtggtccaagaggaaaaaccggcatgcgtttgtcactctgggtttgtcgggacc
agatgcgaacacgccgatctccttgcggtcgtagcggccaaccaaaagaagcaaaccatc
accgccttggtggtggtttctgtgatcgcctcggttgtcctcatcggggtgtgcgtctta
atacactgctgcagggtaaggaagcactgtggttggtgcaggaccgtcgtctgcaggcat
gagaagcccagcggcctcctgaaaggtggatcctcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system