KEGG   Pogona vitticeps (central bearded dragon): 110073542
Entry
110073542         CDS       T05000                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04068  FoxO signaling pathway
pvt04110  Cell cycle
pvt04115  p53 signaling pathway
pvt04218  Cellular senescence
pvt04310  Wnt signaling pathway
pvt04340  Hedgehog signaling pathway
pvt04371  Apelin signaling pathway
pvt04510  Focal adhesion
pvt04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110073542 (CCND1)
   04340 Hedgehog signaling pathway
    110073542 (CCND1)
   04371 Apelin signaling pathway
    110073542 (CCND1)
   04068 FoxO signaling pathway
    110073542 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110073542 (CCND1)
   04115 p53 signaling pathway
    110073542 (CCND1)
   04218 Cellular senescence
    110073542 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110073542 (CCND1)
   04530 Tight junction
    110073542 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110073542
NCBI-ProteinID: XP_020638518
UniProt: A0A6J0SU36
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYQDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRYLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPNELLQMELLLVNKLKWNLAATTPHDFIEHFLNKMPVAEDSKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSKVIKCD
PDCLRACQEQIESLLESSLRQAQQHNISSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctctgctgcgaagtggagaccatccggagagcctaccaagatgcc
aacctcctcaatgacagggtcttgcagacgatgctgaaggcggaggagacctgctcgcct
tccgtctcctacttcaagtgcgtgcagaaggagatcttaccatatatgaggaaaatagtg
gcgacttggatgttggaggtttgtgaggaacagaaatgcgaagaagaagttttccccttg
gctatgaattatttggaccgttatctttctttagaaccccttaagaaaagccgtttgcaa
ctgttgggagctacctgcatgttcgtggcctccaaaatgaaggaaaccattcctctcact
gcagaaaaactgtgtatttataccgataactccattagacccaacgaattactgcaaatg
gaactgctcctggtgaataagctgaaatggaatctggctgccacgacccctcatgatttt
atcgaacattttctaaataaaatgcctgtggcagaggacagcaagcagatcatccgtaaa
cacgcccagacttttgtggctctatgtgctacagatgtaaagtttatttcgaatccacct
tccatgattgcagctggtagtgtggtagcagctgtgcaaggccttcatcttggaaacact
aacacatttctctcttatcaatgcctcacacatttcctatcaaaggttatcaaatgtgac
ccggattgtttacgagcctgccaagaacagattgagtccctccttgaatctagtctacgc
caggcccaacaacacaacatatcttcagaaacaaagactgttgaagatgaagctgatctt
tcctgcacacccactgatgttagagatgtgaatatttaa

DBGET integrated database retrieval system