KEGG   Pogona vitticeps (central bearded dragon): 110073976Help
Entry
110073976         CDS       T05000                                 

Gene name
HTR1A
Definition
(RefSeq) 5-hydroxytryptamine receptor 1A
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110073976 (HTR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pvt04030]
    110073976 (HTR1A)
G protein-coupled receptors [BR:pvt04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    110073976 (HTR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 110073976
NCBI-ProteinID: XP_020639406
LinkDB All DBs
Position
Unknown
AA seq 464 aa AA seqDB search
MELSNSTVAATAGANSSGGGGEPTASPASPTAAASLGYQLGTSVALGALILFAVLGNACV
IAAIALERSLQTVANYLIGSLAVTDLMVSVLVLPMAALYQVLGKWTLGQVTCDIFISLDV
LCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISLTWLIGFLISIPPMLGWRT
PEDRSDPNACTISKDPGYTIYSTFGAFYIPLLLMLVLYGRIFKAARFRIRKTVKKVDKKQ
PAQQPPLPLAAEPSAEPVADTCLSISPASEPKKANGGPPQPLQQAKSWKSAVEPKGGGGG
VCINGALRPGGEDGPVAPSALEILEVTPSNATKSHLPLPNHHHHHHEQQQQPSLPGSATP
ALERKNEPKNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCEEGCYMP
DWLGAVINWLGYSNSLLNPVIYAYFNKDFQSAFKKIVRCKFCTQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtccaacagcacggtggcggcgacggccggagccaatagcagcggcggcggc
ggcgagccgacggcgagtccggccagcccgacggcagcggccagcctgggctaccagctg
ggcacgtcggtggccctcggggcgctgatcctcttcgccgtgctgggcaacgcctgcgtg
atcgcggccatcgcgctggagcgctccctgcagacggtggccaactacctgatcggctcg
ctggccgtcacggacctgatggtgtcggtactggtgctgcccatggccgccctctaccaa
gtgctgggcaagtggaccttgggccaggtgacctgcgacatcttcatctcgctcgacgtg
ctgtgctgcacctcctccattctccacctgtgcgccattgccctggaccgctactgggcc
atcaccgaccccatagactacgtcaacaagcggacgccccggcgggccgcagttctgatc
agcctcacctggctgatcggtttcctcatttctatcccgcccatgctgggctggcggacc
cccgaggaccgctcggaccccaacgcctgcaccatcagcaaggaccccggctacactatc
tactccaccttcggcgccttctacattccccttctcctcatgctggtcctctacgggcgc
atcttcaaggcggcccgcttccgcatccggaagacggtcaagaaagtggacaaaaagcag
ccggcgcagcagccgccgctaccgctggcagctgaaccgtctgcggagcccgtggccgac
acctgtctctccatctcgcccgccagcgagcccaagaaggccaacggaggacctccacag
ccgctgcagcaagccaaaagctggaaaagtgccgtcgagcccaaaggaggcggcggaggc
gtctgcatcaacggggccctccggccagggggtgaggacggcccggtggccccctcggct
ttggagatcctggaggtgacgccttccaacgccaccaaaagccacctgcccctgcccaac
caccaccaccaccaccacgagcagcagcagcagccctccctgccgggctcggccacgccg
gccttggagcggaagaacgagcccaagaacgcggaggccaagcgcaagatggctttggcc
cgcgagcgcaagacggtcaagacgctgggcatcatcatgggcaccttcatcctgtgctgg
ctgcccttcttcatcgtggccctggtcctgcccttctgcgaggagggctgctacatgccc
gactggctgggggccgtcatcaactggctgggctactccaactccctcctcaaccccgtc
atctacgcttacttcaacaaagatttccaaagtgcttttaagaagatcgtccggtgcaag
ttttgcacgcagtga

DBGET integrated database retrieval system