KEGG   Pogona vitticeps (central bearded dragon): 110074829
Entry
110074829         CDS       T05000                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04068  FoxO signaling pathway
pvt04217  Necroptosis
pvt04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110074829 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110074829 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110074829 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pvt03000]
    110074829 (STAT3)
Transcription factors [BR:pvt03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    110074829 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 Syntaxin-6_N AP1AR DUF4795 Fib_alpha Baculo_PEP_C
Other DBs
NCBI-GeneID: 110074829
NCBI-ProteinID: XP_020641135
UniProt: A0A6J0T2G9
LinkDB
Position
Unknown
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEENRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQAVTRQKMQQLEQMLSALDQMRRGIVSELAGLLSAMEYVQKTLVDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPLLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGEVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGINYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEAPDPGTVPYLKTKFICVTPTTCSN
TIELPMSPRTLESLIPFCGNGEGAEGNASGQFESLRVFDMEMTAECANSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccaacttcagcagctagacacacggtatttggagcagctccaccag
ctgtacagtgacagctttccaatggaactccggcagttccttgcaccctggattgaaagt
caggactgggcctatgctgccagcaaggaatcccatgccacactggtgttccacaacctc
ttgggggaaattgaccagcaatacagccgcttcctccaggaatcaaatgttctttaccag
cacaacctgcgccggatcaagcagtttctgcagagcaggtacctggagaaaccaatggaa
attgcccgcattgtagcccgttgcctatgggaagagaatcggctgctgcagactgcagcc
acagcagcacagcaaggcgggcaggcaaaccaccctacagctgcagttgtgacagagaag
cagcagatgctagaacaacacttgcaagatgtaagaaagagggtgcaggacctagagcaa
aagatgaaagtggtggaaaatctccaggatgacttcgatttcaactacaaaaccttaaag
agtcaaggtgacatgcaagatctgaatggaaataaccaggcagtgacacgacagaagatg
caacaactggagcagatgctgtcagcactggatcaaatgcggaggggaattgtgagtgag
ctggctgggctcttgtcagccatggaatacgtgcagaagacgctggtggatgaggagctg
gcagactggaagaggaggcagcagattgcatgcattggtggcccgcccaacatttgcctt
gatcgcctcgagaactggataacatccctggcagaatcccaacttcagacacgccaacag
atcaagaagctggaggagctccagcagaaggtctcgtataagggtgatcccattgtccag
caccgacccctgctggaggagcgcattgtggaattattcaggaatctcatgaagagtgca
tttgtggtagagaggcagccatgtatgcccatgcacccagatcgcccattggttatcaaa
actggggtacagttcacaacgaaagtgcggttactggttaaatttcctgagctcaactac
cagctgaaaatcaaagtctgtattgacaaggattctggtgaagtggctgccctccggggg
tcccggaaatttaacatcttgggcacaaacacaaaggtgatgaatatggaggagtccaac
aatggcagcctctctgcagagttcaagcatttgacactacgggagcagagatgtggtaat
ggtggaagagcaaactgtgatgcctctctcatagtcacggaagagctccatctcatcact
tttgagaccgaggtttatcaccaagggctgaagattgacctagagacccactcacttcct
gtagtggtgatctccaacatctgccagatgccaaatgcctgggcatcgatcttgtggtac
aacatgctgacaaacaatcccaagaatgtgaactttttcaccaagccgcctattggcact
tgggaccaagttgcagaggtgctcagctggcagttctcctcaaccaccaagcgaggcctc
agcattgagcaactgacgacgcttgcagaaaaactccttgggcctggcatcaattattct
ggatgtcagattacatgggcaaagttctgcaaggagaacatggcaggcaaaggcttctct
ttctgggtctggttggataatatcattgatctggtgaagaagtacatcctggcactctgg
aatgaagggtatatcatgggttttatcagcaaagaacgggagagagcaattctgagcacg
aagcctccaggcactttcctgttgcgtttcagtgagagcagcaaagagggtggaatcacc
ttcacatgggtggagaaagacattagcgggaagacccaaatccagtcagtggagccatac
accaagcagcagctgaacagcatgtcctttgctgagattattatgggctacaagattatg
gatgccaccaacatattggtctccccacttgtctacttgtaccctgatattccaaaagag
gaggcttttggaaaatactgccgtccagagagtcaggagcaccccgaagcccctgatcca
ggtacagttccatatctgaagaccaagttcatctgcgtgaccccgacaacttgcagtaac
accattgaactacccatgtctccccgtacacttgaatccttgatccctttttgtggtaac
ggtgagggagccgagggaaatgccagtggccagtttgagtccttgcgagtctttgacatg
gagatgaccgcagagtgtgccaactcacccatgtga

DBGET integrated database retrieval system