KEGG   Pogona vitticeps (central bearded dragon): 110074986
Entry
110074986         CDS       T05000                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04012  ErbB signaling pathway
pvt04068  FoxO signaling pathway
pvt04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110074986
   04068 FoxO signaling pathway
    110074986
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110074986
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 110074986
NCBI-ProteinID: XP_020641449
UniProt: A0A6J0T5T9
LinkDB
Position
Unknown
AA seq 211 aa
MSHVRISNGSPTLERMEARQADYPKPSACRNLFGPVDHEELARELQKHSRDLEEASRRKW
NFDFHRHQPLEGRYEWQAVAKEALPDFYSRPPRLAAAAKAAGQKRRPSGVHGSCPSAAGF
RRSQGISGDGEDEAEAAEQDGLGPVPKAEAAGAPAEFGGQNAGPRKRPASDDSSPRNKRA
NTTEEVISEGSSSASSVEQTPKKSSPRRRQT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgtcccacgtacgcatctcgaatgggagcccgaccctggagcggatggaagcccggcag
gcggactacccgaagccctcggcttgtcggaacctcttcggccccgtcgaccacgaagag
ctagcccgggagctgcagaagcacagccgcgacctggaagaggccagccggaggaagtgg
aacttcgacttccaccgccaccagcccctggaaggccggtacgagtggcaagccgtggcc
aaggaggccctgcccgacttctacagcagaccccccaggctcgccgccgccgccaaagcg
gccggccagaagcggcggccctcgggggtccacggcagctgcccctcggcggcgggcttc
aggcgctctcagggaatctcgggggacggcgaggacgaggccgaggcagccgagcaggac
gggctgggtcccgttccaaaggcggaggcggccggagcgccggcggagttcggcggccag
aacgcggggcccaggaagcgacccgcctcggatgattcctctcctcgaaacaaaagagcc
aacacgacagaagaggtgatttcagaaggctcttccagtgccagctcagtggaacaaacg
cccaagaaatccagcccaaggcggcgtcaaacgtaa

DBGET integrated database retrieval system