KEGG   Pogona vitticeps (central bearded dragon): 110075002
Entry
110075002         CDS       T05000                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04012  ErbB signaling pathway
pvt04068  FoxO signaling pathway
pvt04110  Cell cycle
pvt04115  p53 signaling pathway
pvt04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110075002
   04068 FoxO signaling pathway
    110075002
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110075002
   04115 p53 signaling pathway
    110075002
   04218 Cellular senescence
    110075002
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110075002
NCBI-ProteinID: XP_020641463
UniProt: A0A6J0T2B4
LinkDB
Position
Unknown
AA seq 151 aa
MEPKPAKASHARRNLFGPVDHDNLQQDVQNMLWASMERAMQRWNFDFLQDKPTEGLLQWE
ELPVHEVPTFYHNLVIGQGRYPLQSMNWDVTKETKMSHVGKMMKKTKPAKRIARKKGVAG
KKRRQTSLTDYYTAKKDNRVAMRTPVKKLAI
NT seq 456 nt   +upstreamnt  +downstreamnt
atggagccaaaacctgcaaaagcaagtcatgcaagaagaaatctttttggtcctgtggac
catgataatctgcagcaggacgtccagaacatgttgtgggctagcatggagagggcgatg
caaagatggaactttgacttcttgcaagataagccaacagaaggccttctacaatgggaa
gaattgccagtccatgaggttcccactttttatcataatcttgtgattgggcagggtcgt
tatcctctgcagtccatgaactgggatgtaacaaaggagaccaaaatgtcccatgttggc
aaaatgatgaagaaaacaaagcctgccaaaaggatagcaaggaagaagggtgtggcaggg
aagaagcgaaggcagacatctttaactgattactatacagcgaagaaagataacagagtg
gctatgcgaactcctgtgaagaaactggctatttag

DBGET integrated database retrieval system