KEGG   Pogona vitticeps (central bearded dragon): 110076576Help
Entry
110076576         CDS       T05000                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00512  Mucin type O-glycan biosynthesis
pvt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    110076576 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pvt01003]
    110076576 (GALNT9)
Enzymes [BR:pvt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     110076576 (GALNT9)
Glycosyltransferases [BR:pvt01003]
 O-Glycan biosynthesis
  Mucin-type
   110076576 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 110076576
NCBI-ProteinID: XP_020644509
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSQELVQIVRSADRRIRSRNPKAGTLLD
RESILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGLGQGGMAATLRDDSHESETKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKQMSYPDDLPQIAVVFIFVNEALSVILRSVHSVVNQTP
SHLLKEIILVDDNSDNVELKFNLDQYVHKRYPGLVKIVRNNKREGLIRARIQGWKAATAP
VVGFFDAHVEFNNGWVEPALTRIKEDRRRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQDWLDKGDESAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIP
MTNPGVDFGDVSERVALRQRLQCRSFKWYLEHVYPEMRIYNDTITYGEVRNSKASGYCLD
QGVEDDDKAILYPCHGMSSQLVRYSSEGLLQLGPLGSTAFLPDSKCLIDDGKGRTPTLKK
CEDILRPAQRLWDFTQNGPIISRDTGRCLEVEMSKEANFGLRLVVQRCSGQKWMIRNWIK
HGRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcaaggaagatcaaaactttgctgaccgtcaacatcttggtctttgtgggc
atcatcctcttctcggtctactgccggatccaggaccgttcgcaggagctggtgcagatt
gtccggagcgccgaccgacggatccggagccggaaccccaaggcggggactctgctggac
agggagtccatccttcaacgtctggaccatctggaggaagttgtgtataaccaactcaat
ggtctagccaaaccgatgggattggttgaaggtcctggaggattggggcaaggcggaatg
gctgccaccctgagagatgacagccatgaatctgaaaccaaatatgaagaatatggatat
aacgcccagctaagtgataggatttcacttgacagatctattcctgactacaggcccaaa
aagtgcaaacagatgtcctatcccgatgacctcccccagatcgcggtggtctttattttt
gtgaatgaggctttgtctgtcatcttacgctccgtacacagtgtcgtgaatcaaactcca
tcccatctgctcaaggagattatcctggtggatgacaacagtgacaatgttgagctgaag
tttaatttggaccagtatgttcataagagatacccggggctggtgaaaatagttcgcaat
aacaaacgggaaggtctgatccgagccagaatccaaggttggaaagcagcgacagcgcca
gtagttgggttttttgacgctcatgtggagttcaacaatggctgggtggagccagcgctt
acacggatcaaagaggacaggagacgaatcatcctgccggccattgataacatcaagtac
aacacttttgaagtacagcagtacgccaatgcggctcatggctacaactggggcctttgg
tgcatgtatatcatcccacctcaagactggctggacaagggagacgagtcggctcccatc
aggaccccagcaatgattggttgttcctttgtggtggacagagaatatttcggcgagatt
ggcctacttgaccctggaatggaggtttacgggggagaaaacattgaacttgggatgagg
gtctggcaatgtggaggaagtatggaggtgctgccgtgctcccgggtggcccacatcgag
cgcacaaagaagccgtacaacaatgacatcgattactacgcaaagcgcaatgctttgcga
gcggcggaagtctggatggatgacttcaagtcacatgtgtacatggcatggaacatacca
atgacgaaccccggcgttgactttggagatgtttcggaacgagtagctttacgacaacgt
ctccagtgccggagttttaagtggtatttagagcacgtctatccggaaatgaggatctac
aatgataccatcacctacggagaggtgcgcaacagcaaagccagtggctactgcttagac
cagggcgtagaagatgatgacaaagctattctttatccatgccatggaatgtcttcccag
cttgttcgttacagctcggaaggactcctccagttgggcccattgggatcgacagcattt
ctgccagactccaaatgcctcattgatgatgggaaaggaaggacaccgaccctgaagaaa
tgtgaagatattctgaggccagcccaacggctgtgggatttcacacagaatggtccgatc
atcagccgagacacaggtcggtgtctagaagtagaaatgtccaaggaagccaattttggt
ctcagattagtagtacaaagatgctcggggcagaaatggatgatcagaaactggataaag
catggccggcattga

DBGET integrated database retrieval system