KEGG   Pogona vitticeps (central bearded dragon): 110076658
Entry
110076658         CDS       T05000                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
pvt  Pogona vitticeps (central bearded dragon)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 DUF5663 Ras_bdg_2
Other DBs
NCBI-GeneID: 110076658
NCBI-ProteinID: XP_020644646
UniProt: A0A6J0T7U8
LinkDB
Position
Unknown
AA seq 373 aa
MNRPIDQEMIELKTLGLEKQLDLTRGPRGTPERPVRLERANALRISPGKVPEILSRVRQI
RLLGGQSDPKLTEVLGEGHVFKPFPQSQPTWCDLCGEFIWGVYKKRLQCIHCKFICHYRC
RALIRLDCSGPRYQDGDQNEVNEQTVEKDTNVDEQIDWEKPILSQDEIEQKIKEYNSQIN
SNLFMSLNKDGSYTGFIKVQLKLIRPVSVPANKKAPSIQDTRKSTSRSQAVKRRTSFYLP
KDTVKHLHIISRTRASEVIEALLKKFMVVDNPRKFALFERTEKDDQVYLRKLSDEEQPLR
LRLLAGPSEKALSFVLKENETGEVNWDAFSMPELQNFLRILQREEEEHIRQILQKYAHCR
QKMQEALATRTPG
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaaccgccccatcgaccaggagatgatcgagctgaagaccctgggactcgagaagcag
ctggacctgacgcgaggcccgcgcggcacgcccgaacgccccgtccggctggagcgggct
aacgccttgaggatctccccggggaaagtgcccgagatcctgagccgcgtgcgccagatc
cgcctcttggggggccagagcgaccccaaactgaccgaggtgctgggtgaaggacatgtc
ttcaagcccttccctcagagtcagccgacctggtgcgatctgtgcggagaattcatctgg
ggcgtctacaagaaacgcctgcagtgcatccactgcaagttcatctgtcattaccgatgc
cgtgccctaattcggcttgactgcagtggtcccagatatcaagatggtgatcagaatgaa
gtcaatgagcaaacagtggaaaaagacaccaacgtggacgagcagattgattgggaaaaa
cccattctatcccaagatgaaattgaacagaagataaaagagtataacagccagattaac
agcaacctcttcatgagcttgaacaaagatggttcatacactggctttatcaaggtgcaa
ttgaagctaatacgtcctgtctcagtacctgctaacaagaaggcaccttccatccaggac
accaggaagagtacctcccgcagccaggctgtaaagcgccgcacatcattttacttaccc
aaggacacagtcaagcacctgcacataatttctcgtacacgtgccagtgaagttattgag
gcacttctgaagaaattcatggtagttgacaatccccgcaagtttgctctctttgagaga
acagaaaaggatgaccaagtgtatctccgcaagctttctgatgaggaacagcccttgcgt
ctccgacttttagctggccctagtgaaaaggcactcagctttgttctgaaggagaatgag
actggagaagtcaattgggatgcttttagcatgcctgagctacagaatttcttgcgtatc
cttcagcgtgaagaggaagaacatattcggcagatcctgcagaaatatgcccattgtcgc
cagaaaatgcaagaggctttagccacccgcactccgggttga

DBGET integrated database retrieval system