KEGG   Pogona vitticeps (central bearded dragon): 110076659
Entry
110076659         CDS       T05000                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04010  MAPK signaling pathway
pvt04020  Calcium signaling pathway
pvt04260  Cardiac muscle contraction
pvt04261  Adrenergic signaling in cardiomyocytes
pvt04270  Vascular smooth muscle contraction
pvt04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110076659 (CACNA1C)
   04020 Calcium signaling pathway
    110076659 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110076659 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110076659 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    110076659 (CACNA1C)
   04270 Vascular smooth muscle contraction
    110076659 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pvt04040]
    110076659 (CACNA1C)
Ion channels [BR:pvt04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110076659 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ CAC1F_C PKD_channel
Other DBs
NCBI-GeneID: 110076659
NCBI-ProteinID: XP_020644642
UniProt: A0A6J0T813
LinkDB
Position
Unknown
AA seq 2161 aa
MFQSIVRQATSTYRPLPAHPPEEPGVKYTGRMVHETQLSCFYIPPGGSNYVSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGAAGNATISTASSTQRKRQQYGKQK
KQGTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGVNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYVTGILSDTPAEEEPSPCAPAYAHGRQCQNGS
DCRPGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNMSMPTSETESVNTDNVTGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEPEKPAVEEEMKEEKIELKSIT
ADGESPPSNKGNTDEYQPNENEEKNAYPTTETPGEDEEDEPEMPVGPRPRPMSELHLKEK
AVPMPEASAFFIFSPSNRFRVHCHRIVNDNIFTNLILFFILLSSISLAAEDPVQHYSVRN
QILFYFDIFFTVIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSA
INVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQL
FKGKLYSCSDSSKQTEAECKGSFITYKDGEVSQPMIQPRRWENSKFDFDNVLTAMMALFT
VSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLIL
LNTICLAMQHYGQSCLFKEAMNILNMLFTGLFTVEMVLKLIAFKPKHYFCDAWNTFDALI
VVGSIVDIAITEVNPAEHTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLL
WTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALDDTTDINRNNNFQTFPQAVLLLF
RCATGEAWQEIMLACLPDKRCDPESFEPNNSIEGEHSCGSSFAVFYFISFYMLCAFLIIN
LFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLG
FGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAII
KKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNAL
SLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVNY
YQSDGRSSFPQTFTTQRPLHINKSGNSQGDTESPSHEKLVDSTFTPSSYSSSGSNANINN
ANNTALSRFSSPPNYPSTVSTVEGHNTPLSPPARIREVSWKLGCRRSCSRDSQTAIVCEE
QEVSQEEETYDKQRKEETAYCIEMLSYQDDEHRQLTPHEDNKGEETQYSPKSGFLHSLSL
SRRASFHLECQRKQKKQNTEVNQKTVLPVHLVHHQALAVAGLSPHLQRSHSPLRYSRSCA
TPPTTLCTQDWPQQPIKTLQLDGEESNEKLNNSFPSVYCSSLYSDSTSARRTQKARPVSL
TVPSQTRVCGRQFHGSANSLVEAVLISEGLIQFAQDPKFIETTTQELADACDLTIEEMEN
AADNILNGNSKPSPNGNLLPFVNCRDPGQDCMGDQAEAAQNLDCRKSQEEPVDSRIYISS
L
NT seq 6486 nt   +upstreamnt  +downstreamnt
atgtttcagtccattgttcggcaagcaacctcgacctatcgtccactccctgcacatcca
ccagaagaaccaggggtgaagtatactggcagaatggtccacgaaacccaactgagctgt
ttctacattccaccgggaggttccaactatgtgagtcctcgtccagctcatgccaacatg
aatgccaatgcagctgcaggacttgcacctgagcatatccctactccaggtgcagccctc
tcctggcaggctgctatcgatgctgccagacaggccaaattgatgggtgctgctggcaat
gcaacaatatccaccgctagctccacgcagaggaaacggcagcagtatgggaaacagaaa
aaacagggtaccaccacagctacacggcctccccgtgcattgctgtgtttaacactgaaa
aatcccattcggagggcgtgcatcagtattgttgaatggaaaccatttgaaattattatt
ttactgactatttttgccaattgtgtggccttagctatctatatcccctttccagaagat
gattccaatgctaccaattccaatctggaacgagtggaatatctttttctcataattttt
acagtggaagcatttttaaaagtaatagcatatggacttctctttcaccctaacgcttac
ctccgcaatggctggaatttattagattttataattgtggtagtagggctttttagtgca
attttagaacaagcaaccaaagcagatggggtgaattcaataggaggcaaaggtgctgga
tttgacgttaaagcactacgggcattccgagtattgcgccccttacggctggtatctggt
gttcctagcctccaggtggttttaaattccattatcaaggccatggttcctttgttgcac
attgccctgctggtgctgtttgtcataattatctatgccatcattggacttgagcttttc
atgggaaagatgcacaagacttgttatgtaacgggaatcttatcagatacacctgcagaa
gaggaaccctctccatgtgcacctgcctatgcacatgggcggcagtgtcagaatggaagt
gactgtagaccaggatgggaaggtcccaagcatggcattaccaactttgacaactttgcc
tttgccatgttaactgtctttcaatgcatcaccatggagggctggaccgatgtactgtat
tggatgcaggacgctatgggctatgagttaccctgggtgtactttgtcagtctggtcatc
tttggatcgtttttcgttcttaatctggttcttggtgtgttaagcggggagttttctaaa
gagagagaaaaggcaaaagcccggggagattttcagaaattgcgagagaagcaacagcta
gaagaggacctgaagggatatctagactggataactcaagcagaagatattgacccagaa
aatgaagatgaaggcatggatgaagagaagccccgaaatatgagcatgcctactagtgag
acagaatcggtgaacactgacaatgtaactggaggtgatattgaaggagaaaattgtggt
gcacggctagcgcatcggatatcgaaatctaaatttagccgttattggcgcagatggaat
cggttctgcagacggaaatgtcgagctgctgtcaaatccaatgtgttctattggcttgta
atcttccttgtgtttcttaacaccctcaccattgcttcggaacattacaaccagcctgac
tggctcacagaagtccaagatactgctaataaggtactgctggctcttttcacggctgaa
atgctgctgaagatgtacagcttgggtcttcaagcctattttgtatctctcttcaatcgc
tttgattgtttcattgtatgtggtggaatcctggagaccattttagtggaaacgaagatt
atgtcaccactgggtatctcagtgctgagatgtgtgagactgctgaggatctttaaaatc
acaaggtactggaactctctgagtaatttggtggcttccctgctcaactcggtgcgctcc
attgcttccctgctgctgctactcttcctcttcatcatcatcttctccctcctagggatg
cagctctttgggggaaagtttaactttgatgaaatgcaaaccaggagaagcacgtttgac
aacttcccccagtctctgctcactgtgtttcagatcctgactggggaggactggaattcg
gtgatgtatgatgggatcatggcttatggcggcccctcttttccaggaatgttggtctgt
atttacttcatcatcctcttcatctgtggaaactatatcttgttgaatgtctttttggcc
attgctgtggacaaccttgctgatgctgagagcttaacatctgctcaaaaagaggaggaa
gaggaaaaagaaagaaaaaaattagctagaactgctagtcctgaaaagaaacaggagcct
gagaagccagctgtggaagaggagatgaaggaggagaaaattgagctaaaatccatcact
gctgatggagagtctccgccttctaacaagggcaatacagatgaatatcagccaaatgaa
aatgaagaaaagaatgcctatcctactactgagacaccaggagaggatgaagaagatgag
cctgagatgcctgttgggcctcgtccacgcccaatgtctgaactgcacctcaaggagaaa
gctgtcccaatgccagaagccagcgcttttttcatcttcagccccagtaacagatttcgt
gtccactgccaccgtatagttaatgataacattttcaccaatctgatcctctttttcatc
ttgctcagcagcatctctctggcagctgaggaccctgttcaacactactccgttaggaat
caaattctcttttattttgatatattttttactgtcattttcaccattgaaattgctctg
aagatgactgcctatggggctttcctccacaaaggctccttctgcagaaactacttcaac
attctggacctgctggtggttagcgtttctctcatctcctttgggatccagtctagtgcc
atcaatgtagtgaaaatactacgagtcctgcgagtcctgagaccattgagggctatcaac
cgagccaaaggcctaaagcatgtggtccagtgtgtgtttgtagccatcagaacaatagga
aatattgtgattgtcaccacactgttacagttcatgtttgcctgcattggagttcagctt
ttcaagggcaaattgtatagctgcagcgatagctccaagcaaacagaagctgagtgcaag
ggcagttttattacatacaaagatggagaagtgtctcaaccaatgatccagcctcgaagg
tgggagaacagcaaatttgattttgacaatgttctaactgccatgatggccctcttcact
gtttcaacctttgaaggctggccagaactgctgtaccgatccatagattcccatatggaa
gatgtggggcccatctataaccacagggtggagatctccattttcttcattatctacatc
atcatcatcgctttcttcatgatgaacatcttcgttggtttcgtcatcgtcacttttcag
gagcaaggagagcaagaatacaagaactgtgagctggacaaaaaccagcgccagtgtgtc
gagtatgctctgaaggcccgtcccctgcggaggtatatccccaaaaaccagtaccagtac
aaagtgtggtatgtggtgaattccacctattttgaatacctgatgttcgtcctcatcctt
ctgaacacaatctgcttggccatgcaacactatggacagagctgcctcttcaaagaagca
atgaacattctcaacatgctattcaccggcctgttcaccgttgagatggttctgaagtta
attgctttcaaacccaagcactatttctgtgatgcatggaatacatttgacgccttgatt
gttgtgggtagcattgttgatatagcaatcaccgaggtgaacccagctgaacatacccaa
tgttcttcctctatgaacgctgaagaaaattctcgcatctcaatcacctttttccgactc
tttcgtgtgatgcgcctggtgaagcttttgagtcgaggagagggcatccgcacactgctg
tggaccttcatcaagtctttccaggccctcccctatgtggctctcttgatagtgatgctg
tttttcatctacgctgtgattgggatgcaggtgtttggtaaaattgccctggatgacacc
actgacatcaatcggaacaacaacttccagactttccctcaggcagtgctgctccttttc
agatgtgctactggtgaagcttggcaagaaatcatgctggcatgccttccagataagaga
tgtgatcctgaatcttttgaaccaaacaactctattgaaggtgaacattcctgtgggagc
agttttgctgtcttttatttcatcagcttctatatgctttgtgccttcctgatcattaac
ctttttgtagctgttatcatggataattttgattatctgacacgggattggtcaattctg
ggtcctcatcatctggatgagtttaaacggatctgggcagagtatgatcctgaggccaag
gggcgtatcaaacacctagatgtggtgacactgctgcgtcggatacaacctccactgggt
tttgggaaactctgtcctcatcgcgttgcctgcaagcgtcttgtctccatgaatatgcca
ctgaatagtgatgggacagtaatgtttaatgcaactttgtttgcactcgttcgaacagca
ctgaggatcaaaacagaaggtaacctggagcaagctaatgaagagctgcgagcaatcatt
aagaagatatggaagcgcactagcatgaagctgttggatcaggttgtgcctccagcaggt
gatgatgaggtaacagttggaaagttctatgctacattcctgattcaagaatatttccgg
aaattcaagaaacgcaaagaacagggccttgttggcaaaccttcacaacgaaatgctttg
tctctccaggctggtttgcgtacattacatgacattggacctgagattcgacgggcaatt
tctggagacttaacagcagaagaggaattggacaaggcaatgaaagaagctgtttctgct
gcctctgaagatgatatatttaggagagctggtggattatttggaaatcatgtcaactac
taccaaagtgatgggagaagttcattccctcaaactttcaccactcagcgccctttgcac
atcaacaagtctggcaacagccaaggagacactgaatctccatcccacgagaagcttgtg
gattctaccttcactccaagcagctactcatcatctggctctaatgctaacatcaacaat
gccaacaacactgccttgagccgcttctccagcccaccaaactaccctagcactgtcagc
actgtggaaggccacaacactcctttgtcaccccctgcacggattcgagaggtttcttgg
aaacttggctgcagaagatcgtgttccagagacagtcagacagcaattgtttgtgaagaa
caggaagtttctcaggaggaagaaacatacgataaacaaaggaaagaagaaactgcatac
tgtattgaaatgctctcataccaagatgatgaacatagacagctaactccacatgaagac
aacaaaggagaagaaacccaatactctccgaagagtgggttcctacattccttatcacta
agtcgacgagcatcctttcacctggagtgtcaaaggaaacaaaagaaacaaaatacagaa
gtcaaccagaagacagtcctacctgtgcatcttgtacatcatcaggcactagcagttgca
ggtctcagtcctcatctccaaagaagccattcacctctacggtattctcgatcatgtgcc
acaccccctactactctctgtacacaagattggccacagcaacctattaaaacattgcaa
cttgatggagaggagtctaatgaaaaactcaataatagcttcccatcagtatactgcagc
tctttgtattctgacagcaccagcgccagaagaactcaaaaagccaggccagtctccctc
acagttcccagccagaccagagtgtgtggcaggcaatttcacggcagtgctaacagcctt
gttgaagcggtcttgatttcagaaggactgatacaatttgctcaagacccaaagttcatt
gaaaccacaactcaagaactagctgatgcctgtgatttgacgatagaagagatggagaat
gctgcagacaacattctcaatggtaacagcaagccaagccccaatggcaacctcttgcct
tttgttaattgcagggacccagggcaggactgtatgggagaccaagcggaagcagcccaa
aacctagattgtagaaaaagtcaagaggagcctgtggacagcaggatttatatcagcagc
ctgtaa

DBGET integrated database retrieval system