KEGG   Pogona vitticeps (central bearded dragon): 110076845Help
Entry
110076845         CDS       T05000                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pvt01002]
    110076845 (TMPRSS2)
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     110076845 (TMPRSS2)
Peptidases [BR:pvt01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110076845 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR Ldl_recept_a SRCR DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 110076845
NCBI-ProteinID: XP_020645030
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MASDPNPPPYYENYAYQSENVAAPRYVSAYNMYPPHYTTSYNPPSVPQYVSPVSTQHSTP
VPTIVQPKPSSTKCTPRLRKILCFLLATVISLIGAGIAVVLSWYFVTGSCFGAKIQCGTT
RVCVSPSQWCDGVRDCPNGEDESRCVRLDGPEFVLEVYSSESKTWHPVCYDNWSDKDGKT
ACEDIGYNANTYVSSKAIYYNGSRRFMRLNTSSGNTDLYKKMYNSQSCPSLTVVSLRCIH
CGTSRKSGHPRNRIVGGTAASLGDWPWQVSLHFLDIHLCGGSIITPEWIVTAAHCVEGKY
SNSYYWKAYAGILTQPEMVSFKGHRIAKIISHPDYDSTSKTNDVALMKLQTPLVFNEFIG
PVCLPNSGMMFQPEQKCWISGWGALQQRGNTSKVLNAALVPLIDSRLCNDKYIYNGIILP
TMICAGYLKGKVDSCQGDSGGPLVTTKNSIWWLVGDTSWGAGCAILYRPGVYGNMTVFAE
WIYRNMQANR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgatccaaatccacctccatactatgaaaactatgcctatcagtcagaaaat
gttgctgctccaagatacgtcagtgcctacaacatgtatccgccacattacacaacttcg
tataatcctccatctgtgccgcagtacgtctcaccagtttcaactcagcattcgacacca
gtgccaacaatagtgcagccaaagccttcgtctacaaaatgcacaccaaggctcaggaag
attttgtgtttccttctagcaactgtaatttcattgataggagctggaattgcagttgtt
ctctcctggtactttgtgacaggcagttgttttggcgccaagatacaatgtggaactaca
cgagtatgcgtctcaccatctcagtggtgtgatggagtacgtgattgccctaatggtgaa
gatgaaagtcgctgtgttagacttgatggaccagaatttgtcctggaggtttattcatct
gaaagcaaaacctggcatcctgtatgctatgataactggagtgataaagatgggaagact
gcctgtgaagacataggatataatgcaaacacatatgtcagtagcaaggctatctattac
aatggatctagaagatttatgaggctgaatacaagttctggtaatacagacttgtataag
aaaatgtataacagccaatcatgcccatcattaactgtggtgtctctgcgatgcatacat
tgtggcacatccaggaagagtggacaccctcggaacaggattgtgggtggaactgctgcc
tcccttggagactggccatggcaggtcagccttcatttcctcgatatccatctatgtggg
ggatccattatcactcctgaatggatagtaacagcagctcactgtgtggaagggaaatac
tcaaattcttactactggaaagcttatgctggcattctgacacaaccagaaatggtttct
tttaagggacacagaatagccaaaataattagtcatccagactatgattcaacatctaaa
acaaatgacgttgcccttatgaaattgcagactcctctagtttttaatgaatttatagga
ccagtttgtttgcctaactccggaatgatgtttcagcctgaacaaaaatgttggatatct
ggatggggagcactgcaacagagaggtaacacttccaaagtgctgaatgcagcacttgtc
cccttgatagattcacggctatgtaatgacaaatatatctacaatggaatcatcctgccc
accatgatttgtgctggctacttaaaagggaaagtggattcttgtcagggcgacagtggc
ggtccattggtaactacgaaaaattctatatggtggttagtgggcgatacaagttgggga
gcaggctgtgctatcctatacagaccaggagtttatggaaatatgactgtgtttgctgaa
tggatttacagaaatatgcaggcaaacagatga

DBGET integrated database retrieval system