KEGG   Pogona vitticeps (central bearded dragon): 110077061
Entry
110077061         CDS       T05000                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04010  MAPK signaling pathway
pvt04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110077061 (CACNA1E)
   04020 Calcium signaling pathway
    110077061 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pvt04040]
    110077061 (CACNA1E)
Ion channels [BR:pvt04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110077061 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Other DBs
NCBI-GeneID: 110077061
NCBI-ProteinID: XP_020645405
UniProt: A0A6J0TEH0
LinkDB
Position
Unknown
AA seq 2440 aa
MMLSLGPCSISAHILSEGGSFPAGESTELDSNPLRCALALPEEETWRQHRLGLMHSTQSC
NLLEPDTLTDPLVSRTASFDALYELRSQERDSSLGLDGSSTFDVGQSQLIPVSPEVIKRR
RGGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAMAGRLGSGDGAAEQNRNRQGAP
ASSTGGTPVAYKQTKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDW
PPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGF
VFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQ
IVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYMNNSGKLEEMDPPHPC
GVQGCPAGYECRDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNW
LYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWID
KAEEVMLAEENKNSGTSALEVLRRATIKRSRTEAMNRDSSDERVDISAVGTPLARASIKS
AKLDGASYFRHKERLLRISVRHMVKSQVFYWLVLSIVALNTACVAIVHHDQPPWLTHLLY
YAEFIFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFGIS
VLRALRLLRIFKVTKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRF
NFADGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSSIYFIILTLF
GNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPAIERD
RRRRHHMSMWEPRSSNLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINSEDPPLLNPHA
SIFRRRKVLENSALEKNEESQGGRLERTGGEGQEQPISGSNPCPTIREGQRSPSPQGKRE
WDEWHHKSFHGNCDLNELEGGGSVGFEERARLRQSQRRSRHRRVRTEAKEHRPTAQESAP
EGSGPTEGEADGEPKKNEEKEALIEKKEEASEELKTTNEAPANDADFPVPPQETNSSDSH
LDLKKGCSSKDVSPADQDSSLDTSEQVLLSDLPMETGKTISRSEPDLSSVTTNMEKPTES
TSIMIDVQDSAVVQISTKTDGEASPLKEAETKEEVEVEAEKKQKQKKKRSQKGKPMVPHS
SMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNKVLRYFDY
VFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFIVVVGALMAFALANALGTNKGRDI
KTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLF
KGKFFYCTDSSKDTEKDCIGNYVDHEKGKMEVKCREWKRHEFHYDNIIWALLTLFTVSTG
EGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGD
KMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALN
TVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVI
GSITEIILTDSKLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVC
LLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLGSLMLLFRSATGEAWQEIMLS
CLEGKGCETDTTATSGQNENEQCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTR
DSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLV
LMNMPVAEDNTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEILTIWPHLSQKQL
DLLVPMPKTTDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPQEI
ISNAKALPYLQQDTLSRLSSRSGFPSLSPLSPQEIFQLACMDPNHGEYQEQQSLEPEVRE
FKRVQPSNCGSYLPVDTQERAVSGRASSMPRLTVDPQVVTDPGSMRRSFSTIRDKRTNTS
WLDEFSMERSSENTYKSRRRSYHSALHLSSRRLNTDSGHRSDAHRSGGRERGRSKERKHL
LSPDISRCNSEERSLQADGDSPERHQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTP
RRSRRQLPPVPPKPRPFISYTAMMQHCGNTSPQPEDSEGGSPLLSGVLETNNTCLTESSS
SPQGKQNLLSTPQRYISEPYLMLQDDSHASDCGEEETLTFEAAVATSLGRSNTIASGPRS
RHSWQMPNGHYRRRRRGASQGVMCGASIDVLSDTEEDDKC
NT seq 7323 nt   +upstreamnt  +downstreamnt
atgatgctcagccttggcccatgctccatcagtgctcacattctttctgagggaggctct
ttccctgctggggaatctactgaactggacagcaaccccttgaggtgtgccctggccttg
ccagaagaagagacatggcggcagcaccgtctgggtttgatgcactccactcagtcttgc
aacttgctggagccagacaccttgacagaccctcttgtctcacggactgctagctttgat
gccctctatgaactacgctcacaggagagagattccagtttgggtctggatgggagcagc
acctttgatgtggggcagagccagctcatccccgtcagtcctgaagtcatcaagcgccgg
cgaggtggtctcattgaacagcgggatatcatcaaggcccatgaagcacacaagatgcag
agcacaccacaggccaggcggaaggagtgggaaatggctcgctttggggaggcgatggct
ggccgtttgggatccggagatggagcggcggagcagaacaggaatcgtcaaggggctcct
gcttcgtctacagggggaaccccggtagcgtacaagcaaaccaaagcccaaagggcccgg
actatggcactgtacaaccccatccccgtccgccagaactgcttcacagtcaacagatcg
ctcttcatctttggagaagacaacattgtcaggaaatacgccaagaagctcatcgactgg
ccgccctttgaatacatgattctggcaaccatcattgcaaactgcatcgttctggccctg
gaacagcatctccctgaggatgataagacacctatgtctcggagattagagaagacagaa
ccttatttcattgggatcttttgttttgaagccggcattaaaatagttgctttgggattc
gttttccacaagggctcatatttgcggaatggatggaatgtcatggatttcattgtggtc
ctgagtggcattcttgccacagcagggacacatttcaacacccatgtggatttgcggact
ctgcgggcggtgagagtactcaggcccttgaagcttgtctcaggcattcctagtttacaa
attgtactcaaatccatcatgaaggccatggtgccccttctccagataggcctcctcctc
ttttttgctatcctgatgtttgcaattattggcctggagttctacagtggaaagctgcac
cgggcttgctacatgaacaattcaggtaaattagaagaaatggatccacctcatccttgt
ggggtacaaggatgccctgcaggttacgaatgcagagactggattggtcccaatgatggg
attactcagtttgacaacatcctctttgcagtattgactgtcttccagtgtattactatg
gaaggatggactacagtgctatacaataccaacgatgccttaggagccacctggaactgg
ctatacttcataccgctcatcatcattgggtcattctttgttctcaaccttgtcctagga
gtactttctggggaatttgccaaagagagagagcgagtggaaaatcgacgggcattcatg
aaactcaggaggcagcagcagattgagcgggagctgaatggctacagggcatggatagat
aaagcagaggaagtaatgctggctgaagagaacaaaaattctggcacatcagctttagaa
gttctcaggagggcaactatcaaaagaagccgaacagaagccatgaatcgtgactctagt
gatgagcgcgtggatatctccgctgtaggtaccccacttgctcgtgccagcatcaagagt
gctaaactggatggagcctcatacttccggcacaaggaacggctcttgcgcatctctgtt
cgtcacatggtgaaatctcaagtgttctattggcttgtcttgagcatagtggcactcaac
actgcctgtgtggctattgtccatcatgaccaacctccatggctcacacacctcctctac
tatgcagagtttatatttctggggctcttccttctagagatgtctttgaagatgtatgga
atggggccacgcctttactttcattcttctttcaactgctttgactgtggggtcacagtg
gggagtatctttgaagtggtttgggctatcttcagacctggcacctcttttgggattagt
gtcttgagagctttgagactcctaagaatatttaaagtcacaaagtattgggcttccttg
aggaatttggtggtctcactgatgagttctatgaagtctattatcagcctcctcttcctc
cttttcctcttcattgtagtctttgccctgcttgggatgcagctgtttggtggcaggttt
aattttgcagatgggactccttctgcaaactttgataccttccctgcagccatcatgaca
gttttccagatcttgacaggtgaagactggaatgaggttatgtacaatggaattcgttcc
caaggtggtgtcagctcaggaatgtggtcgtctatctacttcatcatccttactctgttt
gggaactatactctgcttaatgtgttcttggccattgctgtggacaaccttgccaatgcc
caggagctgacaaaggatgagcaggaggaagaagaggcttttaaccagaagcatgccctg
cagaaagccaaagaagtcagcccaatgtctgctcccaacatgcctgcaatagaaagagac
agaaggaggagacaccacatgtcgatgtgggaaccacgctccagcaatctgagggagagg
agaaggcggcatcacatgtctgtgtgggaacagcggaccagccagctccgccgacacatg
cagatgtccagccaggagggcatcaatagtgaggaccctcctttgctcaaccctcatgcc
agtatatttcggagaaggaaggttttggagaattctgcccttgagaagaatgaggagagc
caaggaggcaggctggagaggactggtggggaaggccaagagcagccaatatcgggttcc
aatccctgcccaaccataagagaaggccagaggagcccatctcctcaaggcaaaagggaa
tgggacgaatggcaccacaagtccttccatgggaattgtgatctgaacgagctggaaggt
ggagggagtgtgggctttgaagagagggctcgactccggcaaagtcagaggcgcagccga
caccgcagggtgaggacggaggccaaggaacacaggcccaccgcccaggagtctgcccca
gaaggcagtggcccaacagagggagaggctgatggagagccaaagaaaaatgaggagaag
gaggccctcattgaaaaaaaggaggaggcttctgaggaactgaaaaccaccaacgaggcc
ccagcaaatgatgctgattttcctgtgcccccacaagaaacaaattcctcagacagccac
cttgacttgaaaaaaggatgttcaagcaaggatgtcagtccagctgatcaggatagcagc
ctagacaccagcgaacaagtgctcttaagtgacctgccaatggaaacaggaaagactatt
agcaggagtgagccggacctctcctctgtgacaaccaacatggagaaacccacggagagc
acctccatcatgattgacgttcaagactctgctgtggtacagattagcaccaagacagat
ggagaagccagccctttgaaggaagcagagaccaaggaagaagtagaagtggaagctgag
aagaagcagaagcagaaaaagaagagatctcagaagggcaagccgatggtgcctcatagt
tccatgttcatcttcagtaccacaaacccaatccggagggcctgccattacatcgtcaac
ctgcgctattttgagatgtgcattcttctggtgattgcagcaagcagcattgcattggca
gcagaggaccctgtcctgaccaactcagacaggaataaagtcctgagatactttgactat
gttttcactggtgtgtttacctttgagatggttattaagatgatagatcaaggattaata
ctgcaagatggctcctatttccgggatttgtggaacatcctggatttcattgtggtggtt
ggagcactgatggcctttgccttagcgaatgctttggggaccaacaaaggccgggacatt
aaaacaattaagtctcttcgtgttctacgagtcttgagaccactgaagaccatcaagcgg
ttgccaaaactcaaggcagtctttgactgcgttgtaacatcactgaagaatgtcttcaac
atactcattgtctacaagctcttcatgttcatctttgctgtcatcgcagtccagcttttc
aagggcaaattcttctactgcacagacagctccaaggatacagaaaaagattgcataggc
aactatgtggaccatgaaaaaggcaagatggaagtgaaatgtcgagaatggaagcgccat
gaattccactatgacaacataatttgggctttgcttacactcttcactgtctccactgga
gaaggctggccacaggttcttcagcattcagtagatgtgactgaggaggaccgtggcccc
agccgtagtaaccgcatggaaatgtctattttttatgtggtatattttgtagtattccct
tttttcttcgttaacatttttgtggctctcatcattatcactttccaagagcaaggagac
aaaatgatggaagagtgcagtctcgagaagaatgagagagcatgcattgactttgccatc
agtgcgaaaccccttacccgctacatgccccagaaccgacatacctttcagtaccgagta
tggcattttgtagtctccccatcttttgaatacaccattatggctatgatagcacttaat
acagtggttttaatgatgaagtactattctgctccctacacttatgaactggctctcaag
tatctgaacattgcatttaccatggttttctcactggaatgtgtcctgaaaattatagct
tttggcttcctgaattatttccgtgatacctggaatatctttgatttcatcactgtgatt
ggcagcattacagaaattatcttgacggatagcaagctggtaaatacaagcagcttcaac
atgagctttctgaagttgttccgagctgcccgtctcatcaaactgcttcgccagggttat
accattcgaattctgctgtggaccttcgtgcagtcatttaaggccctcccatatgtctgt
ctcctgattgcgatgctcttcttcatttatgcaatcattgggatgcaggtttttgggaat
atcaaattagatgaagaaagccacataaaccgtcacaacaatttccgcagctttctaggt
tcactcatgcttcttttcaggagtgccacaggggaagcatggcaagagatcatgctttca
tgcctagaaggtaaaggatgtgagacagacaccacagcaacatctgggcaaaatgagaat
gagcagtgtggcacggatctcgcatatgtgtactttgtctccttcatcttcttctgttcc
ttcttgatgctcaatctttttgtggctgtcatcatggacaattttgaatacctgactaga
gactcctccatcttgggacctcaccaccttgatgaatttgtccggatttgggcagagtat
gacagagctgcatgtggccgcatccattacactgagatgtatgaaatgctgactctcatg
tccccaccactaggcctcggaaagagatgtccctccaaagttgcttataagagactggtc
ctgatgaatatgcctgttgctgaggacaacactgtgcatttcacttccaccttgatggca
ctgatccgaacagctctggatattaagattgctaaaggtggtgcagactggcaacagcta
gactctgagctccagaaagagattctgaccatctggcctcacctttcacagaaacaacta
gatttattggtgcccatgccaaaaactacagacctgacagttggaaaaatctatgcagcc
atgatgataatggactattataagcagagtaaagctaagaaacaaagacagcagttggaa
gagcagaaaaatgccccaatgttccagcgcatggaaccttcctctcttcctcaggagatc
atttctaatgccaaagctttgccttacctccagcaagatacactttcaagactgagcagc
cggagcgggttcccatccctgagtccactctctccacaagagatattccagttagcttgc
atggatcccaaccatggagaataccaggagcagcaatctttggagccagaggttagagag
tttaaaagagtgcagccctctaactgtggcagctacctcccggtggatactcaggaacga
gcggtatctgggagggcctcttccatgccacgcctgactgtggatccccaggtggttaca
gatccaggctccatgagacgctcattttctactattcgagacaagcggactaacacctcc
tggttagatgaattctccatggaaagaagcagtgagaacacttataagtcccgtcgtcgc
agttaccattctgcactacatctgtcttcacggcgtctcaacacagactcgggtcatcga
tctgatgcacatcgatcaggaggcagagagagaggccggtccaaggaacgcaaacacttg
ctctctccagacatttcacgttgcaactcagaggaaaggagtcttcaggcagatggtgat
tctccagagcgacatcagtccaggtctcccagtgaaggcaggtcacaaactcccaacaga
cagggcacaggctccttgagtgagagctccatcccttctatctctgacaccagcacaccc
aggcgaagccgccgacagctccctccagtgccccccaagccgcgccccttcatttcttac
actgctatgatgcaacattgtggcaacacctccccacagccagaagatagtgagggtggc
tcccctctgctatctggggttctggagacaaacaacacctgcttgactgagtcttccagc
tccccacaaggaaagcagaaccttctctccacccctcagcgctacatctcagagccttac
ctgatgctccaggatgattctcacgcttcagactgtggtgaggaggagacactcaccttt
gaggctgctgtggccaccagtcttgggcgctccaatacgattgcatcgggccctcgctca
aggcacagctggcagatgcccaatggtcactaccggaggagaagaagaggggcatcacag
ggggtgatgtgtggggccagcatcgatgtactaagtgacacggaagaagacgacaagtgc
taa

DBGET integrated database retrieval system