KEGG   Pogona vitticeps (central bearded dragon): 110077094Help
Entry
110077094         CDS       T05000                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
Enzymes [BR:pvt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     110077094 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 110077094
NCBI-ProteinID: XP_020645488
LinkDB All DBs
Position
Unknown
AA seq 738 aa AA seqDB search
MTEATAAEREKKQGAPPGLSGRRALPPNVSNEEEDDVPTMEFFSPGPRGVMPKDILEVLE
VNIFQREDEINKREHHTDKYYNHRLIVRRGQSFHIQISFSRPYNPVKDQFWIEYLIGRYP
QQNKGTYIRVPLVQELESGQWGAKITHSAGQFVALNIMPAANCIVGKFRMYIAVLTPNGI
LRTKRNPSTDTYILFNPWCPEDDVFLDDEKERQEYVLNDLGVIYYGDPESIKTRSWNYGQ
FEEGVLDACLYLMDRAQLALSGRGNPVKISRVGSAVINAKDDEGVVVGSWDNLYEYGVAP
SSWTGSVDILLEYHSSKEPVRYGQCWVFAGVFNTFLRSLGIPARVITNYSSAHDNDANLQ
MDVFLDENGKIDSRLTKDSIWNYHCWNEAWMSRPDLPVGFGGWQAVDSTPQENSDGMYRC
GPASVQAVKHGHVCFQFDTPFVFAEVNSDIVYSTAMKDGTKVVQRVDKIQVGKLILTKEL
GSDKMKNITEQYKFQEGTEEERLALETALLYGVKKSVTQDITPSAEVDMDFIVEDSALGS
DFNVNITFRNHTQSRYTATSYLSGNVVFYTGVPKGEFKNHSFDVTLDPLQTQTVEVLIKS
REYMSKLVEQASLHFFVTARVNETEKILARQKSVTLKIPQLLLKVPGEKVVGKDMTVIVE
FTNPLKQNLTNIWGRLDGPGLLKPISKLFREVPKNSTLTWEEKCIPKRAGPRKLIASLNC
DALRHVYGELDINIQNAV
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcaacagctgctgagagagagaagaagcaaggggctccccctgggctgagt
gggcggagagccctcccacccaatgtctccaatgaagaagaagacgatgttcccacaatg
gagttttttagtccagggccaaggggggttatgccaaaagatattctggaagtcctggaa
gtcaatatattccagcgtgaagatgaaattaataagcgagagcaccatacggacaaatac
tacaaccaccggttgattgtgcgccgaggccagtctttccatattcagatttctttcagc
cgtccatacaatccagtaaaggatcaattctggattgagtatcttataggacgctatcca
caacaaaacaaaggcacctacatccgagtccctttggttcaagagctggaaagtgggcaa
tggggtgctaagatcacccatagtgctggccagtttgttgccctgaatatcatgccagct
gcaaattgcattgtgggaaaattccgcatgtacattgcagtcttgactccgaatggcatc
ttgcggacaaaacgaaacccaagcacagatacatatatcctcttcaacccctggtgtcca
gaggatgacgtgtttctggatgatgaaaaagaaagacaagagtatgtcctgaatgacctt
ggcgtgatctactatggagaccctgaaagtataaaaaccagaagctggaactatggacag
tttgaagaaggggtcctggatgcttgcttatacctgatggacagagcacagttggctctc
tctggccgaggaaacccagtcaaaatcagccgcgttggctccgcagtgatcaatgctaaa
gatgatgaaggtgtggttgttggttcatgggataatctttatgaatatggagtagcacca
tcatcttggactggaagtgtagacattctactggaatatcacagttctaaagagccagtg
cggtacggtcagtgctgggtctttgctggagtcttcaacacatttttgaggagcctgggg
attcctgcaagagttattactaattattcctcagctcatgacaatgatgccaatttgcag
atggatgtcttcctggatgaaaatggaaagatagattccagactcacgaaagactccatc
tggaactaccactgctggaatgaagcctggatgtccagacctgatcttcctgttggtttt
ggaggctggcaagctgtagatagcactcctcaagaaaacagtgacggcatgtatcggtgc
ggtcccgcctctgttcaggctgttaagcatggacatgtctgcttccagtttgatacacct
tttgtttttgcagaggtaaacagtgatattgtatactcaacagcaatgaaagatggaact
aaagtggttcagcgtgttgacaagatccaggttgggaaattaatcctgacaaaagaattg
ggttctgataagatgaagaacattactgagcagtacaaattccaagaaggcacagaggaa
gagagactggccttggagaccgccctgttatatggtgttaagaaaagtgtgacccaggat
atcacacccagtgcggaggttgacatggatttcatagtggaagactcggcacttggcagc
gattttaatgtcaatattactttccgaaaccatacgcaaagccgctacactgcaacatct
tatctttctggcaatgttgtattttatactggagtcccaaagggagaattcaagaatcat
agtttcgatgtgacactggacccactgcaaactcagactgtcgaggtgctaatcaaatcg
agagaatatatgagcaagttggtggaacaagcctctctgcatttcttcgtcacggcccgt
gtcaacgaaacagaaaagatcctggcccggcaaaaaagtgttacgctgaaaatcccccag
ctgctccttaaggttcctggagagaaagtagttggtaaagacatgacagtgatagtggaa
ttcaccaacccactgaaacagaatctcaccaacatctggggccgacttgacgggcctggt
cttctgaaaccaatctcaaaacttttcagagaggttccaaagaattctaccttgacatgg
gaagaaaaatgcattccgaagagggccggtccccgaaagctgattgcaagcttgaattgc
gatgccttgcgacatgtctacggggagctggacatcaatattcaaaatgctgtgtaa

DBGET integrated database retrieval system