KEGG   Pogona vitticeps (central bearded dragon): 110077208Help
Entry
110077208         CDS       T05000                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pvt01001]
    110077208 (MAPK6)
Enzymes [BR:pvt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110077208 (MAPK6)
Protein kinases [BR:pvt01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110077208 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo
Motif
Other DBs
NCBI-GeneID: 110077208
NCBI-ProteinID: XP_020645690
LinkDB All DBs
Position
Unknown
AA seq 720 aa AA seqDB search
MAEKFESLMNIHGFDVGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPNGSQLTDDVGSLTELNCVYIVQEYMETDLANLVE
QGPLPEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIKNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAAEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDESHSHIYNWDRYHDS
QFSDHEWPVHNNFESDEVQRDPRALSDGTDEEEVQVDPRKYLDGDREKYLEDPAFDTHFS
TEPCWPYPDHHENKYCDLECSHTCNYKRRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEATQQFVEKEKKQGFDFDSFIAGTIQLSLQPE
SSTEIEKLNDLNSSVSHLEPKGIAKSVSREKQEKGMANLAQLEALYQNSWEGQQLVSGGE
ESFLIGQFCCEVRKDEQIEKENPCTSYLDRFFSKKEEAEIVDSEPVDDGKPGEKEREGSF
LSHSGEFLFNKHLEAIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHLN
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagtttgaaagtctgatgaacattcacggctttgatgtaggctctcgctat
atggacctgaaaccattgggctgtggcggcaatggcttggttttctctgccgtcgataac
gactgtgacaaaagagtcgcggtcaagaaaattgtcctgaccgatcctcagagtgtcaaa
catgctctgcgtgagatcaagatcattcgaaggcttgaccatgacaacattgttaaagtg
tttgaaatcctgggtcccaatgggagtcaactgacagacgatgtgggctctctgacagaa
ctgaactgtgtttacattgtccaagagtacatggagacagacctggccaacctggtggag
cagggccccttgccggaagaacacgccaggctcttcatgtaccagctgctacgtgggctc
aagtacattcactcggcaaatgttctgcacagagatctcaagccagctaacctgttcatc
aataccgaagacttggtgctgaaaattggggacttcggccttgcacggatcatggaccct
cattattcccataagggccatctttctgaaggattggtaacgaaatggtacagatcgcct
cgccttttgctgtcgcccaacaactatacaaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgacagggaaaactctctttgcaggcgcacatgaacttgaacag
atgcagctgattttggaatcaattcctgttgtgcatgaagaagaccgccaggaacttctg
agcgtaattccagtttacattaaaaatgatatgactgagccacacaaacctttaactcag
ctcctcccagggattagccgtgaagcactggacttcctggaacaaatcctgaccttcagc
cccatggaccgattgacagcagcagaagctttatcccacccctatatgagtatttactcc
tttccaacagacgagcccatatcaagccatcctttccacattgaggatgaggtggatgac
attctgctcatggatgaaagtcacagccacatctataactgggacagataccatgacagt
cagttttcagaccacgagtggcctgttcacaacaactttgaatccgatgaagttcagcgt
gacccaagggctctttctgacgggactgatgaagaagaggtgcaagtggaccctcgcaaa
tacctggatggcgatcgtgaaaaatacctggaggaccctgcttttgatacccacttttcc
actgagccttgctggccctatccagatcaccatgaaaacaagtactgtgatctggaatgc
agtcatacctgtaattacaaaaggcggtcctcttcgtacctagataatttagtctggaga
gagagtgaggtgaaccattactatgagcccaagctcataatcgatctttctaactggaag
gaacagagcaaagagaagtcagacaaaaaaggaaagtcaaaatgtgaaaggaacggattg
gtgaaagctcagatagctctggaggaagccacacagcagtttgtagaaaaggagaagaag
caggggtttgactttgattcctttatagcaggaaccatccagctgagtttgcagccggag
tcgtccacggagattgagaagctcaatgacctgaacagctctgtgtcccacctagagccg
aaaggcattgccaagtcagtcagccgagagaagcaggagaagggcatggccaacctggcc
cagctggaggctctgtaccagaactcctgggagggccagcagctggtcagtggcggggaa
gagtccttcctcataggccagttttgttgtgaagtcaggaaggacgagcagatagagaag
gagaatccctgcaccagttacctggacaggttttttagcaagaaagaagaggcagagata
gtagactccgagccagttgatgatgggaagccgggggagaaagagagagagggaagcttt
ttaagtcatagtggggaatttcttttcaataagcacctcgaagcgataggtattcctcag
ttccacagtcccgttggctcacctcttaaatcaatacaagccacactaacaccttctgct
atgaagtcatctcctcagattccccataaaacatacagcagcattctgaaacacctaaac
taa

DBGET integrated database retrieval system