KEGG   Pogona vitticeps (central bearded dragon): 110077534Help
Entry
110077534         CDS       T05000                                 

Gene name
ALDH7A1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00010  Glycolysis / Gluconeogenesis
pvt00053  Ascorbate and aldarate metabolism
pvt00071  Fatty acid degradation
pvt00260  Glycine, serine and threonine metabolism
pvt00280  Valine, leucine and isoleucine degradation
pvt00310  Lysine degradation
pvt00330  Arginine and proline metabolism
pvt00340  Histidine metabolism
pvt00380  Tryptophan metabolism
pvt00410  beta-Alanine metabolism
pvt00561  Glycerolipid metabolism
pvt00620  Pyruvate metabolism
pvt01100  Metabolic pathways
Module
pvt_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
pvt_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110077534 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    110077534 (ALDH7A1)
   00620 Pyruvate metabolism
    110077534 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110077534 (ALDH7A1)
   00561 Glycerolipid metabolism
    110077534 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110077534 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    110077534 (ALDH7A1)
   00310 Lysine degradation
    110077534 (ALDH7A1)
   00330 Arginine and proline metabolism
    110077534 (ALDH7A1)
   00340 Histidine metabolism
    110077534 (ALDH7A1)
   00380 Tryptophan metabolism
    110077534 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110077534 (ALDH7A1)
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110077534 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     110077534 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     110077534 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110077534
NCBI-ProteinID: XP_020646315
LinkDB All DBs
Position
Unknown
AA seq 544 aa AA seqDB search
MWLPLRLASLGRRALLRRKGFSSPSPRCGPAAPMSTLLIQQAPYAWLKELGLEEENGGVY
NGTWGGSGEVMTTYCPANNQPIARVRQASLEDYAETVKKAKEAWQIWAEIPAPKRGEVVR
QIGDALRQKIKVLANLVSLEVGKIHVESVGEIQEYVDVCDYAVGLSRMIGGPVLPSERPG
HALIEQWNPVGLVGIISAFNFPVAVYGWNNAVAMVCGNVCLWKGAPTTSLTSVAVTKIIA
QVLEANKLPGAICSLTCGGADIGTAMARDERIDLLSFTGSTNVGKQVALMVQERFGRCLL
ELGGNNAIIVFEDADLNLVIPSALFAAVGTAGQRCTSTRRLFLHESVHDEVVEKLAKSYA
QVRIGDPSDDHTLYGPVHTKQAVQMFVDAVGLAKQQGGSVVYGGKVIDRPGNYVEPTIVT
GLSHTASIVQTETFVPILYVLKFKTEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKG
SDCGIVNVNIPTNGAEIGGAFGGNKHTGGGRESGSDSWKQYMRRSTCTINYSKDLPLAQG
IKFQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcccgctccggctggcttcgctcggcaggcgcgctttgctgaggaggaaaggg
ttctcgtcgccttctccccgctgcggacccgccgcccccatgtcgaccttgctgatccag
caagccccctacgcgtggctgaaggagctgggcctggaggaggagaacgggggagtgtat
aatggcacctggggaggaagcggagaggttatgacaacatattgccctgctaataatcag
ccgatagccagagttcgtcaggccagcttggaagattatgcagaaacagtaaagaaagcg
aaagaggcttggcaaatatgggcagagattcctgcacctaagcgaggagaggtagtgagg
cagattggtgacgccttgaggcagaaaattaaagttctagcaaatttggtttctttagag
gtggggaaaatccatgttgagagtgttggtgaaatacaagaatatgtggatgtctgtgac
tatgctgttggcttatccagaatgatcggtggacctgtccttccttctgaaagacctgga
catgctttaatagagcagtggaacccggtgggattagtagggatcatttctgctttcaac
ttccctgtagccgtttatggctggaacaatgcagttgccatggtctgtggcaatgtctgt
ctctggaaaggtgcacccacgacatcgctcactagtgttgctgttacaaaaataattgct
caagttttggaggctaacaaactgcctggtgcaatctgctctctcacgtgtggtggagca
gatattggcacagctatggcaagagatgaaagaattgatctcctctccttcacgggcagc
acaaatgtgggcaagcaggtggcgctgatggttcaggagagattcggacgctgtcttctt
gagcttggaggaaacaatgctatcattgtgtttgaagatgcagaccttaacctggtcatc
ccatctgccctctttgcggctgtgggaacagcaggccagaggtgcacaagtacaaggagg
ctgtttttgcatgaaagcgtccatgatgaagtggtggaaaaacttgccaagtcatatgca
caagtccgcattggagatccatcggacgatcacaccctgtatggtcctgtccacactaag
caagcagtacagatgtttgtggatgccgtgggattggccaagcagcaggggggctctgtg
gtctatggtggaaaggttatagatcgtcctggaaactatgttgagccaactattgtgact
ggcctttcacatacggcatccattgtgcagacagagacatttgttcctattctgtacgtg
ctaaaatttaagacagaagaagaagtctttgcctggaataacgaagtaaaacaaggtctc
tccagcagcatctttaccaaggatttgggtagaatattcagatggcttggaccgaaggga
tcagactgtggcattgtgaatgtgaatattccaacgaatggtgctgaaattggaggtgcc
tttggtggtaataagcatactggtggtggaagggaatctggaagtgattcatggaagcaa
tacatgagacgatctacttgcacaatcaattacagcaaggatttgcctctggctcaaggg
atcaagtttcagtaa

DBGET integrated database retrieval system