KEGG   Pogona vitticeps (central bearded dragon): 110078407
Entry
110078407         CDS       T05000                                 

Gene name
PDGFRA
Definition
(RefSeq) LOW QUALITY PROTEIN: platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04010  MAPK signaling pathway
pvt04020  Calcium signaling pathway
pvt04144  Endocytosis
pvt04510  Focal adhesion
pvt04540  Gap junction
pvt04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110078407 (PDGFRA)
   04020 Calcium signaling pathway
    110078407 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110078407 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110078407 (PDGFRA)
   04540 Gap junction
    110078407 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110078407 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pvt01001]
    110078407 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pvt04090]
    110078407 (PDGFRA)
Enzymes [BR:pvt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110078407 (PDGFRA)
Protein kinases [BR:pvt01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110078407 (PDGFRA)
CD molecules [BR:pvt04090]
 Proteins
  110078407 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 110078407
NCBI-ProteinID: XP_020648166
UniProt: A0A6J0TI77
LinkDB
Position
Unknown
AA seq 1078 aa
MGPSRRMYLILSCFLTGPWLSTCQSLFPAILPNKDEMVVQLNSPFTLKCSGDSEVNWQYP
IPEGNDTVDIRNEENNSGLFVTVLEVKNASASHTGLYTCYYNHSQEEDGEVEGKDIYIYV
PDPAVPFVPTSPEDVFIVITEEDESTTIPCRTSDPNAQVTLTNSEGKVVYAFYDNRQGFT
GNFSAGSYMCKTIVKAVEFLSGEFFVYVYKATSHLQVEIESPKTVYKTGETVVVSCVVLD
NEVVNLQWNYPGKVKNKGIISLEDIKIPTQKLVYNLTIPDASVKDSGDYECTARHVTKDY
KKTKRVIITVHDKGFIYLEPHFNSMEAVNLHEVKNFAVDVHAYPEPRIFWLKDNVTLMEN
LTEIVTSSKQIQETRYQSIFKLIRAKEEDTGYYTLVAQNEDEIQRYTFSLLIQVPALIXD
LLDNHHGSAGQRVRCLAEGTPLPDVEWLVCKDIKKCSNDSSWTLLTSNVSDITMETRLDE
RNMVESQVTFQKVEETLAVRCMARNDLGTVTRELKLVAPTLRSELTVAAAILVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLNRYPEKTKKDLDIFGMNSADESTRSY
VILSFENNGEYMDMKQAETTQYVPMLERKDRSKYSDIQRSLYDRPASYKKKSLSDDNSEG
LSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNY
VSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFYNKI
KSGYRMAKPDHATNEVYDIMVKCWNSEPEKRPSFYHLSEIVENLLPGEYKKSYERIHLDF
LKSDHPAVTRMRADCDNTYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIPLPDIDPVSE
DELGKRNRHSSQTSEESAIETGSSSSTFVKREDETIDDIDIIDDIGMDSSELVEDSFL
NT seq 3237 nt   +upstreamnt  +downstreamnt
atgggtccttcccgaaggatgtacctgatcctgagctgtttcttgacaggcccatggctg
tccacttgccagtctctgtttcctgctattcttccaaacaaagatgagatggttgtgcag
ctgaattcccccttcactctgaaatgttctggggacagtgaagtcaattggcaataccca
atacctgaaggcaacgatactgtagacatcaggaatgaagagaacaacagtggccttttt
gtgactgtgcttgaagtgaaaaacgcgtcagcttctcacactggattgtatacttgctac
tacaatcattctcaagaagaagatggtgaggttgaggggaaggatatctacatttatgtg
ccagatccagctgtcccctttgttcctacgtctccagaagatgtattcattgtcattact
gaggaagatgaatcgaccaccatcccttgtcgcacaagtgaccctaacgctcaagtaact
ttaacaaacagtgaaggaaaagttgtgtatgccttttacgacaacaggcagggttttacc
ggaaacttctctgcaggctcctacatgtgcaagaccatagtgaaggcagtggagttcctg
tctggagaattttttgtctatgtatacaaagctacttcacatcttcaagttgagattgag
tcccccaagactgtgtataaaacaggagaaacagttgttgtatcttgtgtggtcttggat
aacgaagttgtgaatttacagtggaattatccagggaaagtgaagaacaaaggtatcatc
tcactggaggacatcaaaattccaactcagaaactggtctacaacttgaccatcccagat
gcttcagtgaaggactctggagattatgagtgtactgctcgacacgtgaccaaagactat
aagaaaacaaaaagagtaatcatcacagtccatgataaagggttcatttatttggaaccc
cattttaattccatggaagcagtcaacctacatgaagttaaaaactttgcagttgatgtg
catgcatatccagagccaagaatcttttggctgaaggacaatgtcactctgatggagaat
ctcacagagattgtcactagctctaagcagatccaggagacgaggtatcagagtatattt
aaattaattcgtgccaaggaagaagatactggatactatactcttgtagcacagaatgaa
gatgaaatccaaagatatactttctctttgctcatacaagttccagctttaatttgagat
ctgctagataatcatcatggctcagctgggcagagagtaagatgtttggcagaagggaca
cccctgcctgatgtcgagtggctggtttgcaaggacattaaaaaatgcagcaatgactcc
tcatggactctcctgacaagcaatgtctctgatattaccatggagactcgcctggatgag
agaaacatggttgaaagccaagtgactttccagaaggtggaagaaacactggctgtccga
tgcatggcgaggaatgacctggggaccgttacacgggaactgaagcttgtggctccaact
ttaagatctgaactgactgttgctgctgcaatcctagtgttgctagtgattgtaataatt
tcgctgattgtcctggtaatcatatggaaacagaaaccaagatatgaaatcagatggaga
gtcattgagtccatcagtcctgatggccatgaatatatctatgtggaccccatgcagctg
ccctatgattcaagatgggaatttcccagagatggattagtgctgggtcgaatccttggc
tccggagcatttgggaaagtagttgaaggaactgcctatggattaagccggtcacagcca
gtgatgaaagtggctgtgaaaatgttgaagcccactgcacgatccagtgaaaaacaggct
ctcatgtctgaattaaagataatgacccatcttggacctcacttgaacatagttaacctg
ttaggagcctgtacaaaatcaggtccaatatacatcataacagaatactgcttttatgga
gacttggtgaactacctacataaaaatagggacaactttctgaaccgatatcctgagaag
accaagaaggatctggacatctttgggatgaactcagccgatgaaagtactcggagttat
gtaatcctatccttcgaaaacaatggtgaatatatggacatgaaacaagcagagacaact
caatatgtgccaatgctagaaaggaaagatagatcaaaatattctgacatccaaagatca
ctttatgatcgaccagcttcatataagaagaaatccctatcagatgacaattcagaaggc
ctcagtttgctggacctactaagcttcacttaccaagtggctcgaggaatggagttctta
gcatctaaaaattgtgtgcatcgcgatttggcagcacgaaatgtcctcttggcgcaaggg
aaaattgtgaagatctgtgactttggattggctagagatatcatgcatgactcgaactat
gtgtccaaaggcagtaccttccttccagtgaaatggatggcacctgaaagcatttttgat
aacctgtatacaacattaagtgatgtctggtcttatggcattctgctctgggaaatattt
tctcttggtggtaccccttaccctggcatgatggttgactctacattttataacaaaatc
aaaagtggctatcgaatggcaaagccggaccatgctaccaatgaagtatatgacatcatg
gtgaaatgctggaacagtgaacctgagaaaaggccttctttttaccacttgagtgaaata
gttgaaaatctgttgcctggagaatacaagaagagttacgagaggattcacttagacttc
ctgaagagtgaccaccctgctgtcacacgcatgagagctgactgtgacaacacctacatt
ggagtcacttacaagaatgaggacaaactgaaggacagagagagtggatttgatgaacaa
agactcagtgctgacagtggctacataatccccctgccagatattgaccctgtctctgaa
gatgaacttggaaaaaggaacaggcacagttcccagacatccgaagaaagtgccattgaa
actggttccagcagttctacatttgtcaagcgagaagatgagaccattgacgacattgat
attattgatgacattggaatggattcctcagaactggtggaggacagcttcctgtaa

DBGET integrated database retrieval system