KEGG   Pogona vitticeps (central bearded dragon): 110078807Help
Entry
110078807         CDS       T05000                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00590  Arachidonic acid metabolism
pvt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110078807 (PTGS1)
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     110078807 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 110078807
NCBI-ProteinID: XP_020648968
LinkDB All DBs
Position
Unknown
AA seq 577 aa AA seqDB search
MCSCQVNPSCYFPCQHQGVCVQVGAKGYECDCTRTGYYGRNCSSPEFWSRLRETFRPRPA
FYHFILTHFKWLWDIINTTFIRDTLMRIVLTLRANLIPSPPTYNSDYGYISWESYANVTY
FTRVLPPVPSDCPTPMGTKGPLELPEARLVAERFFLRKTFHPDPQGTNLMFAFFAQHFTH
QFFKTSGKMGHGFTRALGHGVDLGHIYGDNLERQHQLRLFRDGKLKYQMVNGEMYPPTVR
DAPVHMIYPKHIVAEEQMATGQEVFGLLPGLMMYATLWLREHNRVCDLLKGEHPTWEDEQ
LFQTARLILIGETIKIVIEDYVQHLSGYYLKLKFDPELLFGVQFQYRNRIAVEFNQLYHW
HPLMPDSFRIRDREYPYDQFIYNTTMLTDYGVEALVEAFSKQQAGQIGGVANIHKNLLKV
AIGVIEESRLLRLQPFNEYRKRFNMKPYTSFQELTGEEEKAAELEELYGDIDALEFYPGL
LVEKSHPNSIFGESMIEIGAPFSLKGLFGNPICSPEYWKPSTFGGATGFELVNTASLQKL
VCLNVKRCPYVAFRVPEDEEATAPSDTSRRKDLSAEL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcctgccaagtgaatccatcatgctatttcccgtgtcaacaccagggcgtgtgt
gtccaggttggcgcgaaggggtacgagtgtgactgcacacggactgggtactatggcaga
aactgtagctcacctgaattctggtcgcgtctacgggaaaccttcaggccccggccggcc
ttctaccacttcatcttgacccatttcaagtggctttgggacatcatcaacaccacgttc
atccgagacacgctgatgcggatagtgctgacattgcgggccaatctcattcccagcccg
cccacttacaattctgactatgggtacatcagctgggagtcttacgccaatgtcacctac
ttcacccgtgtcctccctccggtgccgagcgactgccccacgcccatggggacaaaagga
ccgttggagctcccggaggcccggctggtcgcagagcgcttttttctccggaagaccttc
caccctgaccctcagggtaccaacctgatgtttgccttcttcgcccagcacttcacccac
cagttcttcaagacatcggggaaaatgggccatggattcaccagggcgctgggccatggg
gtagatcttgggcacatctatggggacaacctggagcgtcaacaccaactcagactcttc
cgagatgggaagctgaagtaccagatggtgaatggggagatgtacccccctaccgtgcga
gacgcccccgtccacatgatctaccccaagcacattgtggcagaggagcagatggccacg
ggccaggaggtgtttgggctcctcccgggactgatgatgtacgccaccctctggctgcgg
gagcacaaccgggtctgcgacctgctgaagggcgagcacccgacctgggaggacgaacag
cttttccagacggcccggctcatcctgattggcgagaccatcaagattgtcattgaggac
tacgtccagcatctcagtggctactacctgaagctgaagtttgacccagaacttctcttt
ggggtgcagttccagtatcggaaccggatcgccgtggagttcaaccagctctaccactgg
cacccattgatgccagactccttcagaatccgggaccgagagtacccctatgaccagttc
atctacaacaccaccatgctgacagactacggcgtggaggccctggtagaggccttctct
aaacaacaagccggccagatcggcggcgtagccaatatccacaaaaacctcctgaaagtg
gccattggcgtcatcgaagaatcgcggctgctgcgccttcaaccctttaatgaatatcgg
aagaggttcaacatgaagccttatacctccttccaggaactgacaggggaggaagaaaag
gcggccgaactggaagagctgtatggtgacattgatgccctggagttctaccctggcctg
ctggtggagaagagccacccaaactccatatttggggagagcatgatagagattggggca
cccttttctctaaagggcctctttgggaaccccatctgttccccggagtactggaagccc
agcacgtttggcggggccaccggcttcgaactggtgaacacggcttcgctccaaaaactg
gtgtgtctcaacgtcaagaggtgcccgtatgtggctttccgagtgccggaggacgaagag
gcgacagcaccgagtgacacgtccaggcggaaagacctctcagccgagctctaa

DBGET integrated database retrieval system