KEGG   Pogona vitticeps (central bearded dragon): 110079231Help
Entry
110079231         CDS       T05000                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pvt01002]
    110079231 (TMPRSS9)
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     110079231 (TMPRSS9)
Peptidases [BR:pvt01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110079231 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 110079231
NCBI-ProteinID: XP_020649785
LinkDB All DBs
Position
Unknown
AA seq 1147 aa AA seqDB search
MGPSAVSAKPALEREAPALPPAKGRPLCVRKTVAALLASALLAGGGGVLVGESLARLEHG
SGPGALSGLLPPHGARRWKGQIPRGKSGRRPVRGPVSPATGPPARPRVSPWGCPSAAAPP
EFGTRSLSSSSSPAFLAQREFAVEHVAELWGIPYESSLEHPGSDYSRMLTPVLEGLFRSS
FQNSSLEGRCARCSVLQYRRGNASVLVRLRLWFSTEPPSPAQEEEALIRGLAAALGGQGI
ALTTYGTLSSVSLAVLADCGARPALQASSRIVGGSQASRGEFPWQVSLRENQEHFCGATI
LSARWLVSAAHCFNEFQDPGSWTAHAGSVWLSGGGEGVGAKAGVARILRHPSYDTDTADY
DIALLELAEPLAFSKYVQPVCLPAASHAFPVGRKCLISGWGYLKEDFLIKPELLQKATVE
LLDQALCTTLYKNALTARMVCAGYLEGKVDSCQGDSGGPLVCEETSGRFFLAGITSWGIG
CAEARRPGVYTRVTKLRDWILHTMAAPPAQPGLSRPTLSWPVASTTVVGGKLRPTVATDW
PAATMAWPQECGRRPGFAKPNKIVGGVDASRGEIPWQVSLQEGLQHFCGATIIGERWLLS
TAHCFNHTKAERLVAFAGITSLAAAETSSVKASVKRVVAHPAYDPARLDFDVALLELSHP
LTFGKYVQPLCLPLAVHKFPAGQKCLISGWGSVREGNASKPENLQRASVGILDQKTCNAL
YNFSLTERMLCAGFLEGQVDSCQGDSGGPLACEETPGVFYLAGLVSWGLGCAQAKRPGVY
TRITKLKGWIVDAMASLRPGTVPGSLVGALPASSSILATSSVPAFSQPSASQGMTRPLLS
TSLRAGASLSRMTASFSRAPLLPGVPCSPSTFKCSSKVCIGKVNPECDGIPDCSNGKDEA
DCDCGLTPATAFSKIVGGSGAARGEWPWQVSLWLRRKEHKCGAVVIAERWLLSAAHCFDR
YSNPKLWVAVLGTPSLSGLDGQVETVARILQHPFYNAYTLDYDMALLELASPLRYSRAVK
PICLPDGTHRFPAGSPCFITGWGSTKEGGPTSKHLQKAAVKLLAEADCRRFYPVQISSRM
LCAGFPQGAVDSCSGDAGGPLACREPSGRWFLAGITSWGYGCARPFFPGVYAKVTAVRGW
IGQNLKE
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atggggccctcggccgtctcggccaagccggcgctggagcgcgaagcaccagcgctaccc
cctgcgaaaggccgccccctgtgcgttcggaagaccgtggccgccctcctggcgagcgct
ctcctggcgggaggtggcggggtccttgtgggtgagtccctcgcccgcttggagcatgga
tctgggccgggagccctttcggggctgcttcctccacatggggccaggcgctggaagggc
caaatccccaggggcaagagcggaaggcggcctgtcagaggcccagtctcgcccgccacg
ggaccccccgcccgtcctcgggtgtccccttgggggtgtccttccgccgccgcccccccg
gagttcggaactcgttccctctcctcctcctcttccccagccttcctggcgcagcgtgaa
tttgccgtggagcacgtggccgagttgtgggggattccttacgagagcagcctggagcac
ccgggctcggactactcccgcatgctcaccccggttctggagggactgttccgaagcagc
ttccagaattcctccctggagggccgctgcgcccgctgctccgtcctgcagtacaggagg
ggcaacgccagcgtcctcgtccgcctccgcctctggttctccacggagccgcccagccct
gcccaggaggaagaggccctgatccgggggctggcggccgccctcggagggcaggggatt
gccttgaccacctacggcaccctctcgtcggtatccctcgcagttcttgcagactgtggc
gcccgcccggccctgcaggcctccagccggatcgtgggcggctcccaggcctcccggggg
gagttcccctggcaggtcagcctgcgggaaaaccaggagcacttctgcggggccaccatc
ctgtccgcccgctggctggtctcggccgctcactgcttcaatgagttccaggatcccggg
agctggacggcccatgcaggaagtgtctggctgagcgggggtggcgagggcgtcggggcg
aaggccggcgtggcccgcatcctacggcacccctcctatgacacagacacggccgactat
gacatcgccctgctggagctggcggagcccttggccttctccaagtatgtccagcctgtc
tgcctgccggccgccagccacgccttccccgtgggcaggaagtgcctcatctcgggctgg
ggatacctgaaggaggacttcttgataaaaccggagctgctgcagaaggcgacggtggag
ctgctggaccaggcactttgcaccaccctctacaagaacgccctgaccgcccgtatggtg
tgcgccggctacctggagggcaaggtggactcctgccagggggactccgggggcccactg
gtctgcgaggagacctccggccgtttcttcctggccggcatcaccagctgggggattggc
tgcgcggaggcccggcgcccaggcgtctacacacgagtcaccaagctcagggactggatc
ctgcacaccatggccgccccccctgcccagcctggcctcagccgcccaacactgtcctgg
cccgtggcctccaccaccgtggttggtggcaagctccgccccactgtggccacggactgg
ccggcagccacaatggcctggcctcaagagtgtggccggaggccaggcttcgccaagccg
aacaagatcgtggggggcgtggacgcctcccggggggagatcccctggcaggtcagcctc
caggagggtctgcagcacttctgcggggccaccatcatcggcgagcggtggctgctctcc
actgcccactgcttcaaccacaccaaggccgagcgcctggtggcctttgcgggcatcacc
tccctggcggccgccgagacctcctcggtcaaggcgagcgtcaagcgggtggtggcgcac
ccggcctatgacccggcccggctggacttcgacgtcgccctgctggagctcagccacccg
ctgactttcgggaagtacgtccagcccctctgcctcccgctggccgtccacaagttccct
gcgggccagaagtgtctcatctctggctggggcagcgtccgggagggcaacgcttccaag
ccagagaacctgcagcgggcctcggtcgggatcctcgaccagaagacctgcaacgccttg
tacaacttctccctcactgagcggatgctctgcgccggcttcctggagggccaggtcgac
tcctgccagggcgactcgggtggacccctggcgtgcgaggagaccccgggggtcttctac
ctggccgggctggtcagctggggcctgggctgtgctcaggccaagaggcccggggtctat
acccggatcaccaagctgaagggctggatcgtggacgccatggcctccctgcgcccgggc
accgtccccgggagcctggtcggagccctgcctgcctcctccagcatcctggccacctcc
tctgtgcccgccttcagccagccctcagccagccaggggatgacgcggcctctgctgagc
accagcctccgggccggcgccagcctctcccggatgaccgccagcttctcccgagctcct
ctgcttccaggtgttccctgcagcccctccaccttcaaatgctccagcaaagtctgcatc
gggaaggtgaacccagagtgcgatggcatcccagactgcagcaacggcaaggatgaggcc
gactgcgactgcggcctgaccccggccacggctttcagcaagattgtggggggcagtggg
gcagcccgcggagagtggccgtggcaggtgagcctgtggctgcgtcggaaggagcacaag
tgcggcgccgtcgtgatcgccgagcgctggctcctgtcggccgcccactgcttcgaccga
tacagcaaccccaagctgtgggtggctgttcttgggacaccctccctgagcggcctggat
gggcaggtggagacggtggctcggatcctccagcaccccttctacaacgcctacacgctg
gactacgacatggcccttctggagctggcctccccactccgctactcgcgggctgtcaag
cccatctgcctccctgacggcacccaccgctttccggcggggtccccgtgcttcatcacc
ggctggggatctaccaaggaaggaggaccgacgtccaaacacttgcaaaaggcagctgtg
aagctgctggcggaggccgactgccggcgcttctaccctgtccagatcagcagccggatg
ctctgtgccggcttcccgcaaggcgccgtcgacagctgctccggcgacgccggcggcccg
ctggcctgccgagagccctctgggcgctggttcctggccggcatcaccagctggggctac
ggctgcgcccgccctttcttcccgggagtctacgccaaagtgacggccgtgcggggctgg
atcgggcagaacctcaaagagtga

DBGET integrated database retrieval system