KEGG   Pogona vitticeps (central bearded dragon): 110079773Help
Entry
110079773         CDS       T05000                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00590  Arachidonic acid metabolism
pvt01100  Metabolic pathways
pvt04370  VEGF signaling pathway
pvt04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110079773 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110079773 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110079773 (PTGS2)
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     110079773 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 110079773
NCBI-ProteinID: XP_020650765
LinkDB All DBs
Position
Unknown
AA seq 602 aa AA seqDB search
MLVLCAAVFSLLALSGAVNPCCSNPCQNRGVCMTTGFDRYECDCTRTGYYGENCTTPEFF
TWLRLTLKPAPDTVHYILTHFKGVWDIINNVPFLRNAAMRYILMSRSHLIESPPTYNSHY
SYKSWEAYSNLSYYTRSLPPVEHNCPTPMGVKGKKELPDSNIIVEKFLLRRKFIPDPQGT
NVMFTFFAQHFTHQFFKTDHHKGPAFTKGLGHGVDLNHIYGETLDRQMKLRLLKDGKLKF
QMIDGEMYPPTVKETQAEMIYPPHTPEHLKFSVGQEVFGLVPGLMMYATLWLREHNRVCD
ILKTEHPEWDDEQLFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHNQEYTYPQFLYNNSIMLEHGLSHMVQSFSKQRAGRV
AGGRNVPAAVMKVAKASIDQSRQMRYRSLNEYRKHFLLKPFKSFEELTGEKEMAAELEEL
YGDIDAMELYPALLVEKPRPGAIFGETMIELGAPFSLKGLMGNAICSPEYWKPSTFGGKV
GFDIINTASIQRLICNNVAGCPLTAFHIVNQETAATSNISTSSTSIDEINPAVLLKERSA
EL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtactctgtgcggctgttttttctctcttggctcttagcggagcagttaaccct
tgctgttcaaatccatgtcagaatagaggagtgtgcatgacaacaggctttgacagatac
gaatgcgactgcacgcgaactggatattatggtgaaaactgcacaacaccggaatttttt
acctggctgcgactgacactaaagccagctcctgacacagtccattacatactcactcac
ttcaaaggagtctgggatatcattaacaatgttccatttcttcgcaatgctgccatgaga
tatatactgatgtcaagatctcacttaattgaaagcccaccgacgtataatagccattac
agctacaagagctgggaagcctactcaaacctttcctactataccagatcacttccacca
gtggaacacaattgccccaccccaatgggagtgaaaggtaagaaagagctaccggattcc
aacatcattgtagagaaattcctgctgaggagaaaatttattccagaccctcaaggcaca
aacgtgatgttcacattctttgcacagcatttcacccaccagttcttcaagacagatcac
cacaaaggaccagcattcacaaaaggccttgggcacggggttgatttaaatcatatctat
ggagagactttggacagacaaatgaaattgagactgcttaaggatggaaaactaaaattt
cagatgattgatggagagatgtatccacccacagtgaaagaaactcaagcagaaatgatc
tatccaccccacacccctgagcacctgaaattttctgtagggcaagaggtctttggcttg
gttccaggattgatgatgtatgccacattgtggcttcgagaacacaaccgggtctgtgat
attctcaagacagagcatccagaatgggatgatgagcagctgttccaaacagccagattg
atcttgataggtgagaccatcaagattgtgattgaagattatgtgcagcacttaagtggt
tatcacttcaagctgaagtttgatccagagcttctcttcaatcaacggtttcagtatcag
aacagaatagcagcagaattcaacaccctctaccactggcatcctcttctgcctgacacc
tttcagatacacaaccaagagtacacttatccacagttcctctacaacaactccatcatg
ctggaacatggcctctcccatatggtgcagtctttctccaagcaaagggctggaagggta
gctggcggtaggaatgttcccgctgcagttatgaaagtagctaaagcttccattgatcaa
agcagacagatgagatatcgatctctgaatgagtaccggaagcattttctactgaagcct
ttcaagtcatttgaagaacttacaggagaaaaagaaatggcagcggaacttgaagagctc
tatggagatatcgatgctatggagctgtatccagcccttcttgtagaaaaaccacgtcct
ggagccatctttggtgaaaccatgatagagcttggagccccattttctctgaagggtctc
atgggaaatgcaatctgctcacccgagtactggaagccaagcacatttgggggcaaagtg
ggctttgacattattaacacagcctccatccagagacttatctgcaacaatgtggcgggc
tgtcctcttacagctttccatattgtaaaccaagaaacagcagcaacaagcaacatcagc
acttctagcacatcaatagatgagatcaacccagcagtactactaaaagagcgatctgct
gaactatag

DBGET integrated database retrieval system