KEGG   Pogona vitticeps (central bearded dragon): 110079972
Entry
110079972         CDS       T05000                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt04012  ErbB signaling pathway
pvt04068  FoxO signaling pathway
pvt04110  Cell cycle
pvt04115  p53 signaling pathway
pvt04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110079972 (CDKN1A)
   04068 FoxO signaling pathway
    110079972 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110079972 (CDKN1A)
   04115 p53 signaling pathway
    110079972 (CDKN1A)
   04218 Cellular senescence
    110079972 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110079972
NCBI-ProteinID: XP_020651152
UniProt: A0A6J0TS64
LinkDB
Position
Unknown
AA seq 182 aa
MYSDESKCGAQSCRPEGASGAAASGKVPSEGAANMPLSGSNIRQPSCSRKLCRNLFGPVD
HEQLQKDFQSLMRVQLEEAQQKWNFDFETETPLEGNYKWEKVSHLNLLQSQDLLSPTKEN
SCAGEKRSSPVHLKKLAKTESPVQVGLEACKTGSPRSLKRKQTSMKDFYSSKRRTVPYKS
KP
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtactccgacgaaagcaagtgcggagctcagagctgccgaccggagggcgcgtcgggt
gcagcggccagcgggaaggtgccgagcgagggagctgcaaacatgcctctgtctgggagc
aacatccggcaaccttcctgcagtaggaagctgtgcagaaacctctttggaccagtggat
catgaacagctccagaaggacttccagtccttaatgagggttcagctggaagaggcccag
caaaagtggaattttgactttgaaacagaaaccccacttgaagggaactacaaatgggag
aaggtctcccatctcaacctgctccagtctcaggacctgctgagccccacaaaggagaac
agttgcgctggtgaaaagagatcgtcccctgtacacctgaagaagcttgcaaagacagag
agtccggtgcaggtgggccttgaggcttgcaagactggttccccaaggagcctgaaacga
aagcagacaagtatgaaagatttctacagctcaaagaggagaactgtcccatataagtcc
aagccatga

DBGET integrated database retrieval system